PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593638.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 463aa    MW: 52012.1 Da    PI: 6.677
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593638.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS450.11.5e-137924632374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  L++cA+a+s++dl +a++++++l++++s +g+p+qRl ay++e+L a+la+s+s++yk+l+  +++   s+e l+++++++ev+P++kf+++
  XP_013593638.1  92 RADLVSCAQALSENDLMMAHSMMEKLRQMVSVSGEPIQRLGAYLLEGLVAKLASSGSSIYKSLNRFPEP--ASTELLSYMHILYEVCPYFKFGYM 184
                     678************************************************************988887..599********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdis.qGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                      aN aI ea+++e+rvHiiDf+i+ qG QW++L+qa+a+Rp+gpp++RiTg+++ +s   +   l+ +g+rLak+A++++vpfefn  v+ + ++
  XP_013593638.1 185 SANGAIAEAMKEENRVHIIDFQIGtQGSQWVTLIQAFAARPGGPPRIRITGIDDTTSAyaRGGGLSIVGNRLAKLAKQFNVPFEFNS-VSVSASE 278
                     ***********************659****************************998899999************************.7999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++l++L v+ gEalaVn+++ lhr++desvs++++rd++L++vkslsPkvv++veqe+++n++sF+ rf e+++yy a+f+s++++lpr++++ri
  XP_013593638.1 279 VKLKDLGVRAGEALAVNFAFVLHRMPDESVSTKNHRDRLLRMVKSLSPKVVTLVEQESNTNTASFFPRFKETMDYYDAMFESIDVTLPRNHKQRI 373
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+r++vn++acega+r+erhe l+kWr+r+e+aGF+++pls  +++++k+llr+++++ yr+ee++g+l+lgW++r Lv+ +aW+
  XP_013593638.1 374 NVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFEMAGFSSYPLSPLVNSTIKSLLRNYSDK-YRLEERDGALYLGWMQRDLVASCAWK 463
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.61565444IPR005202Transcription factor GRAS
PfamPF035145.1E-13592463IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MYKHPRQKTE AYTLPPFEAS SVGKLSSAHE DTSGSCVTDD FNDKIKELET VMMGPDSLDL  60
VFDYNDSFDS TSCQETNSWR STLEAISRRD LRADLVSCAQ ALSENDLMMA HSMMEKLRQM  120
VSVSGEPIQR LGAYLLEGLV AKLASSGSSI YKSLNRFPEP ASTELLSYMH ILYEVCPYFK  180
FGYMSANGAI AEAMKEENRV HIIDFQIGTQ GSQWVTLIQA FAARPGGPPR IRITGIDDTT  240
SAYARGGGLS IVGNRLAKLA KQFNVPFEFN SVSVSASEVK LKDLGVRAGE ALAVNFAFVL  300
HRMPDESVST KNHRDRLLRM VKSLSPKVVT LVEQESNTNT ASFFPRFKET MDYYDAMFES  360
IDVTLPRNHK QRINVEQHCL ARDVVNIIAC EGADRVERHE LLGKWRSRFE MAGFSSYPLS  420
PLVNSTIKSL LRNYSDKYRL EERDGALYLG WMQRDLVASC AWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-62954638375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013593638.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525330.0AK352533.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593637.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X3
RefseqXP_013593638.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X3
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0D3DBQ40.0A0A0D3DBQ4_BRAOL; Uncharacterized protein
STRINGBo7g089080.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]