PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 473aa    MW: 53261.6 Da    PI: 7.3091
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593636.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4501.6e-1371024732374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  L++cA+a+s++dl +a++++++l++++s +g+p+qRl ay++e+L a+la+s+s++yk+l+  +++   s+e l+++++++ev+P++kf+++
  XP_013593636.1 102 RADLVSCAQALSENDLMMAHSMMEKLRQMVSVSGEPIQRLGAYLLEGLVAKLASSGSSIYKSLNRFPEP--ASTELLSYMHILYEVCPYFKFGYM 194
                     678************************************************************988887..599********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdis.qGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                      aN aI ea+++e+rvHiiDf+i+ qG QW++L+qa+a+Rp+gpp++RiTg+++ +s   +   l+ +g+rLak+A++++vpfefn  v+ + ++
  XP_013593636.1 195 SANGAIAEAMKEENRVHIIDFQIGtQGSQWVTLIQAFAARPGGPPRIRITGIDDTTSAyaRGGGLSIVGNRLAKLAKQFNVPFEFNS-VSVSASE 288
                     ***********************659****************************998899999************************.7999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++l++L v+ gEalaVn+++ lhr++desvs++++rd++L++vkslsPkvv++veqe+++n++sF+ rf e+++yy a+f+s++++lpr++++ri
  XP_013593636.1 289 VKLKDLGVRAGEALAVNFAFVLHRMPDESVSTKNHRDRLLRMVKSLSPKVVTLVEQESNTNTASFFPRFKETMDYYDAMFESIDVTLPRNHKQRI 383
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+r++vn++acega+r+erhe l+kWr+r+e+aGF+++pls  +++++k+llr+++++ yr+ee++g+l+lgW++r Lv+ +aW+
  XP_013593636.1 384 NVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFEMAGFSSYPLSPLVNSTIKSLLRNYSDK-YRLEERDGALYLGWMQRDLVASCAWK 473
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.61575454IPR005202Transcription factor GRAS
PfamPF035145.5E-135102473IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MYKHPRQKTE AYTLPPFEAS SVGKLRYIPA HNSLKRSAHE DTSGSCVTDD FNDKIKELET  60
VMMGPDSLDL VFDYNDSFDS TSCQETNSWR STLEAISRRD LRADLVSCAQ ALSENDLMMA  120
HSMMEKLRQM VSVSGEPIQR LGAYLLEGLV AKLASSGSSI YKSLNRFPEP ASTELLSYMH  180
ILYEVCPYFK FGYMSANGAI AEAMKEENRV HIIDFQIGTQ GSQWVTLIQA FAARPGGPPR  240
IRITGIDDTT SAYARGGGLS IVGNRLAKLA KQFNVPFEFN SVSVSASEVK LKDLGVRAGE  300
ALAVNFAFVL HRMPDESVST KNHRDRLLRM VKSLSPKVVT LVEQESNTNT ASFFPRFKET  360
MDYYDAMFES IDVTLPRNHK QRINVEQHCL ARDVVNIIAC EGADRVERHE LLGKWRSRFE  420
MAGFSSYPLS PLVNSTIKSL LRNYSDKYRL EERDGALYLG WMQRDLVASC AWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-621054738375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013593636.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525330.0AK352533.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593636.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X2
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0D3DBQ40.0A0A0D3DBQ4_BRAOL; Uncharacterized protein
STRINGBo7g089080.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]