PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 497aa    MW: 55734.4 Da    PI: 7.0795
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593626.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.71.9e-1371264972374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  L++cA+a+s++dl +a++++++l++++s +g+p+qRl ay++e+L a+la+s+s++yk+l+  +++   s+e l+++++++ev+P++kf+++
  XP_013593626.1 126 RADLVSCAQALSENDLMMAHSMMEKLRQMVSVSGEPIQRLGAYLLEGLVAKLASSGSSIYKSLNRFPEP--ASTELLSYMHILYEVCPYFKFGYM 218
                     678************************************************************988887..599********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdis.qGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                      aN aI ea+++e+rvHiiDf+i+ qG QW++L+qa+a+Rp+gpp++RiTg+++ +s   +   l+ +g+rLak+A++++vpfefn  v+ + ++
  XP_013593626.1 219 SANGAIAEAMKEENRVHIIDFQIGtQGSQWVTLIQAFAARPGGPPRIRITGIDDTTSAyaRGGGLSIVGNRLAKLAKQFNVPFEFNS-VSVSASE 312
                     ***********************659****************************998899999************************.7999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++l++L v+ gEalaVn+++ lhr++desvs++++rd++L++vkslsPkvv++veqe+++n++sF+ rf e+++yy a+f+s++++lpr++++ri
  XP_013593626.1 313 VKLKDLGVRAGEALAVNFAFVLHRMPDESVSTKNHRDRLLRMVKSLSPKVVTLVEQESNTNTASFFPRFKETMDYYDAMFESIDVTLPRNHKQRI 407
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+r++vn++acega+r+erhe l+kWr+r+e+aGF+++pls  +++++k+llr+++++ yr+ee++g+l+lgW++r Lv+ +aW+
  XP_013593626.1 408 NVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFEMAGFSSYPLSPLVNSTIKSLLRNYSDK-YRLEERDGALYLGWMQRDLVASCAWK 497
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.61599478IPR005202Transcription factor GRAS
PfamPF035146.5E-135126497IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MYKHPRQKTE AYTLPPFEAS SVGKLRYIPA HNSLKRYCML EPSSSSLVSP AYAVLSNANS  60
SAHEDTSGSC VTDDFNDKIK ELETVMMGPD SLDLVFDYND SFDSTSCQET NSWRSTLEAI  120
SRRDLRADLV SCAQALSEND LMMAHSMMEK LRQMVSVSGE PIQRLGAYLL EGLVAKLASS  180
GSSIYKSLNR FPEPASTELL SYMHILYEVC PYFKFGYMSA NGAIAEAMKE ENRVHIIDFQ  240
IGTQGSQWVT LIQAFAARPG GPPRIRITGI DDTTSAYARG GGLSIVGNRL AKLAKQFNVP  300
FEFNSVSVSA SEVKLKDLGV RAGEALAVNF AFVLHRMPDE SVSTKNHRDR LLRMVKSLSP  360
KVVTLVEQES NTNTASFFPR FKETMDYYDA MFESIDVTLP RNHKQRINVE QHCLARDVVN  420
IIACEGADRV ERHELLGKWR SRFEMAGFSS YPLSPLVNST IKSLLRNYSD KYRLEERDGA  480
LYLGWMQRDL VASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-621294978375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013593626.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525330.0AK352533.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593626.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593627.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593629.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593630.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593631.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593632.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593633.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593634.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
RefseqXP_013593635.10.0PREDICTED: scarecrow-like transcription factor PAT1 isoform X1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0D3DBQ40.0A0A0D3DBQ4_BRAOL; Uncharacterized protein
STRINGBo7g089080.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]