PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 276aa    MW: 30016.5 Da    PI: 8.5929
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822205.81.2e-6321351146
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +G +klpk++DnneVlkALc+eAGw+vedDGttyrkg+kp++++e ++ s+sasp+ss+q
  XP_013593572.1   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGTFKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQ 96 
                     5899******************************************************************************************* PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                             +sp+ sy++sp+sssfpsp++    +  +a+sl+p+l++ls+ 
  XP_013593572.1  97 --------PSPRGSYNPSPSSSSFPSPTN----PFGDANSLIPWLKNLSSK 135
                     ........*******************98....56677899****999864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-593132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGTF KLPKHCDNNE VLKALCNEAG  60
WTVEDDGTTY RKGCKPTDRM ELMNGSTSAS PCSSYQPSPR GSYNPSPSSS SFPSPTNPFG  120
DANSLIPWLK NLSSKSPSKL PFFNGNSISA PVTPPLARSP TYDQVTIPDS GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDKE AFKMGDSSSP MWTPGQSGNC SPAIPAGVDQ NSDVPMADGM  240
AAEFAFGMVK PWEGERIHGE CVSDDLELTL GNSRTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593572.10.0PREDICTED: BES1/BZR1 homolog protein 3-like
SwissprotO494041e-168BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A0D3DEY50.0A0A0D3DEY5_BRAOL; Uncharacterized protein
STRINGBra012570.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-150BES1/BZR1 homolog 3