PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013592561.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 344aa    MW: 39502.4 Da    PI: 8.2359
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013592561.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF657.6e-212368651
                    HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +s +  +++kR+ +++KKAeELS+LC++ev+vi ++s+g+l+++++
  XP_013592561.1 23 SSLKAASLAKRQVTVFKKAEELSILCGVEVCVICYGSDGELRTWPK 68
                    677889**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.0E-4469IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-1724101IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.6762670IPR002100Transcription factor, MADS-box
CDDcd002663.88E-162691No hitNo description
PfamPF003191.9E-132866IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-53247IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-54768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MSSSLSKTTK VSQFRPTLFQ KASSLKAASL AKRQVTVFKK AEELSILCGV EVCVICYGSD  60
GELRTWPKDR EKVKDMALRY SQLSEVKRRI KQWDLDKFLE EVNKDPKKKN KKKKVKLESS  120
YEYPDWDPMF DNCSVEQLTE LIQSLERKET IMQDRLRAVV ESQRQRSMRY VNMSNQEPTQ  180
MNHLQQQLPD QAQSLAPLPN SLTVYQYPNM DDMYSSFLGG QETGRNEFLS TNMIPYNSFN  240
SNCVNMFQNQ FNQNCSKVED YSGFPQGTGI NNMNVEDYSG ALWAQGTNGL QNMDMYGYNN  300
NSNTNGFSHQ LVQFPAQRAA PACQYVDGST QNIRPQFQYS SFVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592561.10.0PREDICTED: MADS-box transcription factor 47-like
SwissprotQ9LSB21e-82AG103_ARATH; Agamous-like MADS-box protein AGL103
TrEMBLA0A0D3ACI70.0A0A0D3ACI7_BRAOL; Uncharacterized protein
STRINGBra037571.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.12e-75AGAMOUS-like 103