PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013592150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family FAR1
Protein Properties Length: 698aa    MW: 78584.4 Da    PI: 6.1877
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013592150.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR173.83.8e-2396180290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +Yn+YA+++GF +r+++s ++++++e   + ++C++eg+++ ++ +    +++r+etrtgC+a++++++ + ++w+v++++l+HnH++ 
  XP_013592150.1  96 YYNSYARDLGFAIRVKSSWTKRNSKEKRGAVLCCNCEGFKTLKEPN----STRRKETRTGCQAMIRLRLIELDRWKVDEVKLDHNHSFD 180
                     9****************************************98777....89999*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-2096180IPR004330FAR1 DNA binding domain
PfamPF105511.3E-24299392IPR018289MULE transposase domain
PROSITE profilePS509668.877580619IPR007527Zinc finger, SWIM-type
PfamPF044341.0E-6582618IPR007527Zinc finger, SWIM-type
SMARTSM005756.9E-5594621IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MMGGNNVYSP PDQSLSPNSN LCITIEEVSQ SSEQLVVDGD DDLPIVGDNP ADDLHDCDGL  60
LDEFPAQSNG SEKCSLASPP PATGMEFDSY DDAYSYYNSY ARDLGFAIRV KSSWTKRNSK  120
EKRGAVLCCN CEGFKTLKEP NSTRRKETRT GCQAMIRLRL IELDRWKVDE VKLDHNHSFD  180
PERAHNSKSH KKACGGGDGG AAKRKHEPPL DVQVRTIKLY RTNAIDSSGE TSDDHLHSSK  240
RLDLRGGGGF RVLQDFFFQS QLTNPNFFHS VDLGDDGGLR NVFWIESRAR AAYSHFSDVV  300
VFDTTCLSNA YELPLVAFVG INHHGDPILL GCGLVADQTP ETYVWLFRAW LTCVSGCPPL  360
TFVTEHCKSI QTAVSEVFPR AHHRLSLSHV LQCIVGVQDS ESFRMALNSV VYGFLKVEEF  420
EVAWEEMIIR FGLTNDETIR GLFQDREQWA PVYLKDTFLA GALTFRLGNA AAPFIFSSYV  480
HQHTSLREFL EGYESFLDKK YTNEALCDLE SSKSIPELKT THPYESQMAK VLTKEIFTRF  540
QEEVVATSSC SGVTQVHSSN GSASSSYVVK EREGEKVRDF EVVYETNAVA GVRCFCVCGG  600
FSFNGYQCRH VLLLLSHKGL EEIPSQHILQ RWRKDVKRLY IADFGSGCVD VMNPVQWYEH  660
LHRRAMQVVE QGMRSKEHCR VAWEAFKECV NRVTEKSS
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development. May have a role in controlling flowering time. {ECO:0000269|PubMed:15591448}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013592150.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324710.0AC232471.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026K21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592150.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 8
SwissprotQ9S7930.0FRS8_ARATH; Protein FAR1-RELATED SEQUENCE 8
TrEMBLA0A0D3CVJ40.0A0A0D3CVJ4_BRAOL; Uncharacterized protein
STRINGBo6g080100.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142332021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G80010.10.0FAR1-related sequence 8
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]