PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013592147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 530aa    MW: 59068.7 Da    PI: 6.1678
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013592147.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.44.7e-1371625303374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      +L+ecA+av++ d +++++l+++l++++s +g+p+qRl ay++e+L arla+s+s++ykal++++ +     e l+++++++e++P++kf++  
  XP_013592147.1 162 GTLYECAKAVENCDVAMTDWLISQLQQMVSVSGEPVQRLGAYMLEGLVARLASSGSSIYKALRCKDPT---GPELLTYMHILYEACPYFKFGYES 253
                     689****************************************************************9...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aI eav++e+ vHiiDf+isqG+QW++L++aL +Rp+gpp++RiTg+++p+s+  ++  le +g+rL k+Ae +gvpfef+  +a  ++++e
  XP_013592147.1 254 ANGAIAEAVKNESFVHIIDFQISQGGQWVSLIRALGARPGGPPRVRITGIDDPRSSfaRQGGLELVGQRLGKLAEMCGVPFEFHG-AALCCTEVE 347
                     *****************************************************999999**************************.899****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +e+L v++gEalaVn+ l lh+++desv++e++rd++L+lvk+lsP+vv++veqea++n+++Fl rf+e++++y a+f+s+++kl+r+++eri+v
  XP_013592147.1 348 IEKLGVRNGEALAVNFPLVLHHMPDESVTVENHRDRLLRLVKRLSPNVVTLVEQEANTNTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINV 442
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+++l+re+vn++aceg er+erhe l+kWr+r+++aGFkp+pls+++++++k ll+ ++++ y++ee++g+l+lgWk++pL++ +aWr
  XP_013592147.1 443 EQHCLAREVVNLIACEGVEREERHEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEK-YTLEERDGALYLGWKNQPLITSCAWR 530
                     ************************************************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.646134511IPR005202Transcription factor GRAS
PfamPF035141.6E-134162530IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MYNSIIKMEA TQKHIIQDGS SMFYHQPSVK QMDISVQTFD SYCTLESSSG TKSHPCPNNN  60
ITSSTTSFSS NGSPVSHSNN NNNTSHLSPD NNNSPLSGSS ATNNNETELS LMLKDLETAM  120
MEPDLDNSFN GYEFGQQQQQ HRAASSAMYR SMEMISRGDL KGTLYECAKA VENCDVAMTD  180
WLISQLQQMV SVSGEPVQRL GAYMLEGLVA RLASSGSSIY KALRCKDPTG PELLTYMHIL  240
YEACPYFKFG YESANGAIAE AVKNESFVHI IDFQISQGGQ WVSLIRALGA RPGGPPRVRI  300
TGIDDPRSSF ARQGGLELVG QRLGKLAEMC GVPFEFHGAA LCCTEVEIEK LGVRNGEALA  360
VNFPLVLHHM PDESVTVENH RDRLLRLVKR LSPNVVTLVE QEANTNTAPF LPRFVETMNH  420
YLAVFESIDV KLARDHKERI NVEQHCLARE VVNLIACEGV EREERHEPLG KWRSRFHMAG  480
FKPYPLSSYV NATIKGLLES YSEKYTLEER DGALYLGWKN QPLITSCAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-611635307375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.78290.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013592147.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592147.10.0PREDICTED: scarecrow-like protein 5 isoform X1
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A0D3CPS90.0A0A0D3CPS9_BRAOL; Uncharacterized protein
STRINGBo6g022330.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]