PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591899.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family FAR1
Protein Properties Length: 817aa    MW: 94349.2 Da    PI: 7.6889
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591899.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.54.6e-2862150291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fY++YAk++GF++++++s++sk+++ +++++f Cs++g++ e+++  +++ r++++++t+Cka+++vk+++dg+w ++++ +eHnHel p
  XP_013591899.1  62 FYQDYAKSMGFTTSIKNSRRSKKTKDFIDAKFACSRYGSTPESESG-SSSGRRSSVKKTDCKASMHVKRKSDGRWIIHEFIKEHNHELLP 150
                     ****************************************999998.888889999*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-2562150IPR004330FAR1 DNA binding domain
PfamPF105512.0E-25271364IPR018289MULE transposase domain
PROSITE profilePS509668.716551587IPR007527Zinc finger, SWIM-type
PfamPF044347.2E-6553586IPR007527Zinc finger, SWIM-type
SMARTSM005752.1E-5562589IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MDLQESNNNQ MSDANMVESH NNNEDVGGVI VDDLRTGGHL GALDLEPRDG IAFDTHEAAY  60
TFYQDYAKSM GFTTSIKNSR RSKKTKDFID AKFACSRYGS TPESESGSSS GRRSSVKKTD  120
CKASMHVKRK SDGRWIIHEF IKEHNHELLP ALAYHFRIQR NIKLAEKNNI DILHAVSERT  180
RKMYVEMSRQ SGGYKNNKGL LLLQTSEVDK GRRCLALEEG ESQLLLEYFK RIKKENPRFF  240
YAIDLNEEQR LRNLFWADAK SRDDYVSFND VVSFDTTYVK FNDKLPLALF IGVNHHSQPM  300
LLGCGLVADE STETFAWLIK TWLRAMGARA PKVILTDQDK LLMAAVSELL PNTRHCFALW  360
HVLEKLPEYF SHVMKRHENF LRKFNKCIFR SWTSDQFDMR WWKMVSQFGL ENDEWLLWLH  420
EHRQKWVPTF MSEVFLAGMS TSQRAESVNS FFDKYVHKKI TLKEFLRLYG VMLQNRYEEE  480
SVADFDTCHK QPALKSPSPW EKQMAATYTH TIFKKFQVEV LGVVACHPRK EKEDENMVTF  540
RVQDCEKDDE FLVTWSKTQS ELCCFCYMFE YKGFLCRHAL MILQMCGFAS VPPRYILKRW  600
TKDAKSGGAD QIQTRVQRYN DLCCRAIELS EEGCVSEENY NIVLRTLVET LKNCVDLNHA  660
RNNFAESNSQ LNNGAHEEEN HVLAAVKATK KKTVVRKRKG QPEASQMLES QPSLQPMENI  720
SSEGMSMSGY YGPQQNVQGL LNLMEPPHEG YYVNQRTIQG LGQLNSIAPV QDSFFTNQQA  780
MPGLGQMDFR PPPNFAYNLQ DEHLRSAQLP GSSSRQL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'. Activates the expression of FHY1 and FHL involved in light responses. Positive regulator of chlorophyll biosynthesis via the activation of HEMB1 gene expression. {ECO:0000269|PubMed:11889039, ECO:0000269|PubMed:12753585, ECO:0000269|PubMed:18033885, ECO:0000269|PubMed:22634759}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013591899.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated after exposure to far-red light. Subject to a negative feedback regulation by PHYA signaling. {ECO:0000269|PubMed:18033885}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0789410.0AY078941.1 Arabidopsis thaliana AT4g15090/dl3590w mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591899.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_013702274.10.0protein FAR-RED IMPAIRED RESPONSE 1-like
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A0D3CSJ40.0A0A0D3CSJ4_BRAOL; Uncharacterized protein
TrEMBLA0A3P6G8H50.0A0A3P6G8H5_BRAOL; Uncharacterized protein
STRINGBo6g054750.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein
Publications ? help Back to Top
  1. Domergue F, et al.
    Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.
    Plant Physiol., 2010. 153(4): p. 1539-54
    [PMID:20571114]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Wang C, et al.
    SCAB3 Is Required for Reorganization of Actin Filaments during Light Quality Changes.
    J Genet Genomics, 2015. 42(4): p. 161-8
    [PMID:25953354]
  4. Wang W, et al.
    A pair of light signaling factors FHY3 and FAR1 regulates plant immunity by modulating chlorophyll biosynthesis.
    J Integr Plant Biol, 2016. 58(1): p. 91-103
    [PMID:25989254]
  5. Ma L, et al.
    Arabidopsis FHY3 and FAR1 Regulate Light-Induced myo-Inositol Biosynthesis and Oxidative Stress Responses by Transcriptional Activation of MIPS1.
    Mol Plant, 2016. 9(4): p. 541-57
    [PMID:26714049]
  6. Siddiqui H,Khan S,Rhodes BM,Devlin PF
    FHY3 and FAR1 Act Downstream of Light Stable Phytochromes.
    Front Plant Sci, 2016. 7: p. 175
    [PMID:26941752]
  7. Liu L,Li B,Liu X
    FAR-RED ELONGATED HYPOCOTYL3 promotes floral meristem determinacy in Arabidopsis.
    Plant Signal Behav, 2016. 11(10): p. e1238545
    [PMID:27660915]
  8. Ma L,Xue N,Fu X,Zhang H,Li G
    Arabidopsis thaliana FAR-RED ELONGATED HYPOCOTYLS3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1) modulate starch synthesis in response to light and sugar.
    New Phytol., 2017. 213(4): p. 1682-1696
    [PMID:27859295]
  9. Liu Y, et al.
    Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1.
    Plant Cell, 2017. 29(9): p. 2269-2284
    [PMID:28842534]
  10. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]