PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 359aa    MW: 40781.6 Da    PI: 5.3491
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591362.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.82.7e-36381371100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aC+aCk++rr+Ca+dC+lapyfpaeqpk f+nvh lFG++ ++k+l++l+e ++++am+s+++++ +r r+P++G++g+ ++lq  +  +++el+
  XP_013591362.1  38 ACSACKYQRRRCATDCPLAPYFPAEQPKIFQNVHSLFGVRSIIKILENLDEAQKPEAMKSIIFQSYVRDRNPIHGCLGITQQLQYMIWLAEEELK 132
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     +++++
  XP_013591362.1 133 MINSQ 137
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.49237138IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-3438135IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSQIKTIHNL IGSLEKLLDL LLLSLIIFMT LKGGTSGACS ACKYQRRRCA TDCPLAPYFP  60
AEQPKIFQNV HSLFGVRSII KILENLDEAQ KPEAMKSIIF QSYVRDRNPI HGCLGITQQL  120
QYMIWLAEEE LKMINSQLQI HRNNTNTWQY HHNAHNQMSH EIGEKLEDVT SQLNLGVGLM  180
VNNNQNNTIP FFSPLPVFER QPQQPQMSYT YSSSEINNNC YSSPVYTDSC KEILTTNNNN  240
VDASLAWGQN RFPYHHNNGF SNQNEHCNET KSNNGVTAIQ SQLVNHQMVS NQQDEVDDVE  300
YDEIHQFLEI IDDKQSFPDT KLTYASSCSS GESLKERTDE TGESELRSAA TCFSLTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-22341387111LOB family transfactor Ramosa2.1
5ly0_B2e-22341387111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013591362.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591362.10.0PREDICTED: LOB domain-containing protein 27-like isoform X1
SwissprotQ9STS61e-124LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078J5G00.0A0A078J5G0_BRANA; BnaC01g42830D protein
STRINGBo1g072490.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-112LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]