PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 246aa    MW: 28683.7 Da    PI: 5.5253
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590890.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.57.1e-23959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+ ++nrq+t+skR++g++KKA+ELS+LCd++ a+++fs++++l  +ss
  XP_013590890.1  9 KPIQKSTNRQITYSKRKKGLIKKAYELSTLCDIDLALLMFSPSDRLCIFSS 59
                    6899*****************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.371161IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-29160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-26281IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-21323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.2E-211155IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRAKLEIKP IQKSTNRQIT YSKRKKGLIK KAYELSTLCD IDLALLMFSP SDRLCIFSSE  60
TRIEDVLAKY INLPDQEREN AIVFPDRSKR QGIQNKEYLL RTLEQLKTEN DMAFQINEPR  120
YEAIHSDVKE LEKELCRLQQ QLQISEEELR KFEPDPVRFT SMEEMEACEN HLLSTLTRMV  180
QRREHLLSRS FEAPSTQQSI ENIEGWEPEA EFKQARIIAN SAYASNQLSY DLPLQGIISN  240
PTQTPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17193193Myocyte-specific enhancer factor 2B
1tqe_Q2e-17193193Myocyte-specific enhancer factor 2B
1tqe_R2e-17193193Myocyte-specific enhancer factor 2B
1tqe_S2e-17193193Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590890.10.0PREDICTED: truncated transcription factor CAULIFLOWER D isoform X1
RefseqXP_013652474.10.0PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X1
SwissprotQ9LM464e-97AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A078DGK11e-178A0A078DGK1_BRANA; BnaC06g38450D protein
TrEMBLA0A0D3D1G61e-178A0A0D3D1G6_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.2__2429__AT1G77950.21e-137(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.21e-125AGAMOUS-like 67