PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590808.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 451aa    MW: 50338 Da    PI: 6.8854
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590808.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.61.8e-126514511374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal.............. 81 
                     l++lL+++A+++s+++ ++aq++L+ l  ++sp+gd+++Rl++ ft+AL+ r+       ++  ++++t+e++ss+++++               
  XP_013590808.1  51 LRRLLFTAADFISQSNVSAAQNILSILTSNSSPYGDSTERLVHLFTKALSVRIGL-----SENAATWTTNEMTSSTVFTSSvckeqflfrtknnn 140
                     689**************************************************87.....45555555555554444333346667788899999 PP

            GRAS  82 ........kl.fsevsPilkfshltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp......egppslRiTgvgspesgskeel 158
                              l +++++P+++fshltaNqaIl+a+e++    ++Hi+D+disqGlQWp+L+qaLa+R+       +ppslRiTg+g+    + + l
  XP_013590808.1 141 nsdlescyYLwLNQLTPFIRFSHLTANQAILDATETNngnGALHILDLDISQGLQWPPLMQALAERSssnpssTPPPSLRITGCGR----DVTVL 231
                     99888765226************************9888799************************97766655699*********....***** PP

            GRAS 159 eetgerLakfAeelgvpfefnvlvak..rledl..eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqead 247
                     ++tg+rL++fA++lg++f+f++lv    +l+ l  +++ L+++   gE++aVn+v+ lhr++++ +++     ++L+++ksl+P++v+++e+ea+
  XP_013590808.1 232 NRTGDRLTRFANSLGLQFQFHTLVIAeeDLAGLllQIRLLALSAvqGESIAVNCVHFLHRFFNDAGDMIG---HFLSAIKSLNPRIVTMAEREAN 323
                     **********************944312443223366666665556****************99999999...********************** PP

            GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                     h+++sF++rf+eal++++a+fdslea+lp++s+er ++E++++g ei +vva+e aer++rh+++e W+e++++ GF +vp++++a +qaklllr
  XP_013590808.1 324 HGDPSFVNRFSEALDHFMAIFDSLEATLPPNSRERLTLEQRWFGMEILDVVAAEAAERKQRHRRFEVWEEMMKRHGFANVPIGSFAFSQAKLLLR 418
                     *********************************************************************************************** PP

            GRAS 343 kvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ++ s+gy+++  ++sl+lgWk+r L+svS+W+
  XP_013590808.1 419 LHYpSEGYNLQFLNDSLFLGWKNRLLFSVSSWK 451
                     ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.68225430IPR005202Transcription factor GRAS
PfamPF035146.2E-12451451IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010223Biological Processsecondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MNQKSIFLSF QMLASFKSSS SSSEDATENP PPPPPLCLAS SSAATSAAHH LRRLLFTAAD  60
FISQSNVSAA QNILSILTSN SSPYGDSTER LVHLFTKALS VRIGLSENAA TWTTNEMTSS  120
TVFTSSVCKE QFLFRTKNNN NSDLESCYYL WLNQLTPFIR FSHLTANQAI LDATETNNGN  180
GALHILDLDI SQGLQWPPLM QALAERSSSN PSSTPPPSLR ITGCGRDVTV LNRTGDRLTR  240
FANSLGLQFQ FHTLVIAEED LAGLLLQIRL LALSAVQGES IAVNCVHFLH RFFNDAGDMI  300
GHFLSAIKSL NPRIVTMAER EANHGDPSFV NRFSEALDHF MAIFDSLEAT LPPNSRERLT  360
LEQRWFGMEI LDVVAAEAAE RKQRHRRFEV WEEMMKRHGF ANVPIGSFAF SQAKLLLRLH  420
YPSEGYNLQF LNDSLFLGWK NRLLFSVSSW K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-595945026377Protein SCARECROW
5b3h_D3e-595945026377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the axils of leaf primordia and leaves from P1 to P20/22. In the axil of P1, expressed in 3 to 5 cell layers including the L1 to L3 layers of the shoot apical meristem (SAM). Then, extends from 1 or 2 cell layers in the adaxial-abaxial dimension. From P5 to P22, expression is restricted to a 1 to 2 cell-layer domain located within primordium. In the axils of older leaf primordia, expression decreases until it is no longer detectable in the axils of primordia older than P20/P22. {ECO:0000269|PubMed:12730136}.
UniprotTISSUE SPECIFICITY: Expressed in roots and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for axillary (lateral) shoot meristem formation during vegetative development. Seems to act upstream of REVOLUTA. {ECO:0000269|PubMed:12730136}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013590808.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3242340.0HQ324234.1 Brassica oleracea cultivar T9 transcription factor LAS (LAS) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590808.10.0PREDICTED: scarecrow-like protein 18
SwissprotQ9ZWC50.0SCL18_ARATH; Scarecrow-like protein 18
TrEMBLA0A0D3CR210.0A0A0D3CR21_BRAOL; Uncharacterized protein
TrEMBLA0A3P6H4690.0A0A3P6H469_BRAOL; Uncharacterized protein
STRINGBo6g034670.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113292733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.10.0GRAS family protein
Publications ? help Back to Top
  1. Zhang B, et al.
    Novel function of a putative MOC1 ortholog associated with spikelet number per spike in common wheat.
    Sci Rep, 2015. 5: p. 12211
    [PMID:26197925]