PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 179aa    MW: 20447.9 Da    PI: 10.1317
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.6e-4260135277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv++C+adl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCr+rLa+hnerrrk++
  XP_013590498.1  60 CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAKRSCRKRLAGHNERRRKSS 135
                     **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.5E-581147IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.104.1E-3354121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.96657134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3859138IPR004333Transcription factor, SBP-box
PfamPF031102.9E-3260133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MDGKKTQGQG YLKKKASVSY LVEEELENDT DGEEEEKRKG VTDRFKGSSG SNDRGSSRLC  60
QVDRCTADLK EAKQYHRRHK VCEVHAKASS VYLTGVKQRF CQQCSRFHEL LEFDEAKRSC  120
RKRLAGHNER RRKSSGESIG EGSGGRRGIT AQMIQNQERS RVEMTLPMSN TSFKRPQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-4547133184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534391e-124AK353439.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-M04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590498.11e-130PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ9S7582e-82SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A0D3CQM41e-129A0A0D3CQM4_BRAOL; Squamosa promoter-binding-like protein
STRINGBra039656.1-P1e-116(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.27e-65squamosa promoter binding protein-like 4