PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590172.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 307aa    MW: 32896.6 Da    PI: 8.4755
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590172.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221931.1e-5921361133
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspessl 94 
                     ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkgs+++ e++e+++ sa++sp++s+
  XP_013590172.1   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEQDGTTYRKGSSRPvERMEIGVGSATTSPCASY 96 
                     5899*********************************************************************9999****************** PP

          DUF822  95 qsslkssalaspvesysas.pksssfpspssldsislasa 133
                     + s++ss++ sp  +  +s   +s +p  ++l+++s++sa
  XP_013590172.1  97 NPSPVSSNFMSPSYANLTSgDGQSLIPWLKHLSTTSSSSA 136
                     *999999999987554443145566666666666655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.0E-533133IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEQDGTTY RKGSSRPVER MEIGVGSATT SPCASYNPSP VSSNFMSPSY ANLTSGDGQS  120
LIPWLKHLST TSSSSASSSS RLPSFMYLPG GSISAPVTPP LSSPTARGMN QINNSFFVSS  180
TPPSPTRQQT VPGSEWFAGI QLAQSVPASP TFSLVSRNPF GFREDQLASA GGGGGSRMWT  240
PGQSGTCSPA IPQTGDVPMS EAVAPPEFAF GSNANGLVKA WEGERIHEES GSDDLELTLG  300
NSSTRCN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590172.10.0PREDICTED: BES1/BZR1 homolog protein 4
RefseqXP_013685899.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-162BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A078DGR30.0A0A078DGR3_BRANA; BnaC06g39100D protein
TrEMBLA0A0D3D1M40.0A0A0D3D1M4_BRAOL; Uncharacterized protein
STRINGBra035060.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-154BES1/BZR1 homolog 4