PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013589882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 301aa    MW: 34156.1 Da    PI: 4.7673
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013589882.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573102.92.7e-3234128397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     ++r+w+e+De+++L+Gl++++ kt  +ps d+d+f+ fv++si++++sk+ql++K+r+L++Kf  +++++++g++p f++  d+++f++s++iWg
  XP_013589882.1  34 IKRIWNEDDELSILKGLVEYRVKTRHDPSFDWDGFFCFVQGSIHVRFSKEQLFSKVRKLRRKFVLHMERIDRGEDPLFTRLTDSQAFGYSNMIWG 128
                     68********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.7E-2635128IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MATLKRLNFS DTCLQKSPSE EVSTKKKKLA SPVIKRIWNE DDELSILKGL VEYRVKTRHD  60
PSFDWDGFFC FVQGSIHVRF SKEQLFSKVR KLRRKFVLHM ERIDRGEDPL FTRLTDSQAF  120
GYSNMIWGLN QGEVAANGGG TEKAPGDTQE DEPLDNAGRV NDNGDESSKL DGKDSEFADG  180
GMENVMQIES DENASREKGR VSNDEPVNEN GAEKGELDGK ESHDDDDDEL RVVEDAFETT  240
ILQGLSDWQR NLQLKKLMMN LGTEKRKELS NEWKALCSEE VKLKIKKLRF TVKLVEAAND  300
G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589882.10.0PREDICTED: uncharacterized protein LOC106298324 isoform X2
TrEMBLA0A078GNW20.0A0A078GNW2_BRANA; BnaC06g12070D protein
TrEMBLA0A0D3CSS70.0A0A0D3CSS7_BRAOL; Uncharacterized protein
STRINGBra039500.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.13e-75DNA-binding storekeeper protein-related transcriptional regulator