PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013589879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 375aa    MW: 42945.2 Da    PI: 6.3831
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013589879.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-1096139447
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                     +k  rr+++NReAAr+sR+R+ka++++Lee   +L++  ++L k
  XP_013589879.1  96 DKMKRRLAQNREAARKSRLRRKAYVQQLEESRLKLSQLEQELEK 139
                     7899**************************98888888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-489151IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-890140No hitNo description
PROSITE profilePS502179.3795139IPR004827Basic-leucine zipper domain
PfamPF001703.8E-796139IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.09E-697140No hitNo description
PROSITE patternPS000360100115IPR004827Basic-leucine zipper domain
PfamPF141441.4E-30179253IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MMSSFSPTQL ASLRDMGIYE PFQQLVSWGN VYKSDINDHS PNTASSSVIQ VDARIDDHNN  60
IVKSNYASTS HNHIEAEPSS NDHQDVDDDD DDRIHDKMKR RLAQNREAAR KSRLRRKAYV  120
QQLEESRLKL SQLEQELEKA KQQGLRVSNS IPSGSITNAR IATFEMEHSH WLEEQSRRVS  180
ELRIALQAHI SDIELRMLVE SCLNHYANLF RMKSDAAKAD VFYLISGMWR TSTERFFQWI  240
GGFRPSELLN VVMPYLQPLT DQQVLEVRNL QQSSQQAEEA LSQGIEKLQQ SLVENIVVDA  300
FSMDYPPQMA AALENLQALE GFVNQADHLR QQTLQQMAKI LTTRQSARGL LALGEYLHRL  360
RALSSLWAAR PREPT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013589879.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589879.10.0PREDICTED: transcription factor TGA7
RefseqXP_013650012.10.0transcription factor TGA7-like
RefseqXP_013650014.10.0transcription factor TGA7-like
RefseqXP_022560826.10.0transcription factor TGA7-like
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A0D3D1G40.0A0A0D3D1G4_BRAOL; Uncharacterized protein
TrEMBLA0A3P6H3T00.0A0A3P6H3T0_BRAOL; Uncharacterized protein
STRINGBo6g121590.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]