PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013589663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 213aa    MW: 24270.4 Da    PI: 5.5018
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013589663.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF787e-253583149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k+i+++s+rqvtfskRr+g++KKA ELSvLC+a++ +i fs +g++y++
  XP_013589663.1 35 KQISEESKRQVTFSKRRTGLFKKAAELSVLCGAQIGIITFSRRGRIYTF 83
                    689*********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.6332787IPR002100Transcription factor, MADS-box
SMARTSM004329.4E-292786IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-242896IPR002100Transcription factor, MADS-box
CDDcd002652.15E-302894No hitNo description
PRINTSPR004045.4E-222949IPR002100Transcription factor, MADS-box
PfamPF003191.5E-233783IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-224964IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-226485IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MEYGERSSTA CLPLKEEKLQ QNPKTTKGRQ KIEIKQISEE SKRQVTFSKR RTGLFKKAAE  60
LSVLCGAQIG IITFSRRGRI YTFGNADTLV ENYLRRTPVM LRSHPGGDMA NEGEEVDGLK  120
WWERTVESVP EEEMEEYMTA LNGLRDNLWT RICQLGGDQT VQMNAPVFQN QMAEIEWKLT  180
DENVTVRNDQ GQAGDDGYLD VAAGTFLSQI RKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589663.11e-159PREDICTED: MADS-box transcription factor 23
TrEMBLA0A0D3D0381e-159A0A0D3D038_BRAOL; Uncharacterized protein
STRINGBra003884.1-P1e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46972052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72350.15e-77M-type_MADS family protein