PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013589514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 212aa    MW: 24126.5 Da    PI: 7.7936
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013589514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.94.8e-225098149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k i+++ +rqvtfskRr+g++KKA ELSvLC+a++ +i fs   ++y +
  XP_013589514.1 50 KEIQEENRRQVTFSKRRTGLFKKAAELSVLCGAQIGIITFSRCERIYAF 98
                    67999*************************************9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.35E-2242111IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.06342102IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-2642101IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-204464IPR002100Transcription factor, MADS-box
PfamPF003198.2E-225298IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-206479IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-2079100IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MENGEASLTT CLPFKEQKPM QTPNLAVKQR NGRKQQNPKT TKGRQRIEIK EIQEENRRQV  60
TFSKRRTGLF KKAAELSVLC GAQIGIITFS RCERIYAFGN VNTLIESYLR KTPVMLRSYY  120
GGDVATGVDG DGPMWWERAV ESVPEEEMDE YMKGLNGLRE NLWTRICEMS GDPTAQMNAQ  180
ICPDLMAPVN WKLMDENLTV KNDQGQAGYD GY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895750.0AC189575.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011C10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589514.11e-159PREDICTED: MADS-box transcription factor 57-like
RefseqXP_013690325.11e-159PREDICTED: MADS-box transcription factor 57-like
TrEMBLA0A078IML81e-159A0A078IML8_BRANA; BnaC06g24370D protein
TrEMBLA0A0D3CX451e-159A0A0D3CX45_BRAOL; Uncharacterized protein
STRINGBra003884.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46972052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72350.11e-70M-type_MADS family protein