PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588993.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 257aa    MW: 28744 Da    PI: 4.2275
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588993.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.53.5e-132361139
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                    k+i nk  r +tfskRr g+  KA  L+vL da++a++ 
  XP_013588993.1 23 KKITNKASRATTFSKRRDGLYSKAAQLCVLSDARIAILA 61
                    689*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.1331566IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-141576IPR002100Transcription factor, MADS-box
CDDcd002666.84E-191696No hitNo description
PRINTSPR004043.3E-81737IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-171790IPR002100Transcription factor, MADS-box
PfamPF003192.6E-132465IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-83752IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MVFRFVAISK MVKGGTKRKP EMKKITNKAS RATTFSKRRD GLYSKAAQLC VLSDARIAIL  60
ATPSSSSNSN ASFFSFGHSS VESVVSAYLA GQRLPPVSSR DTKATREDLG ICVARKDLGL  120
GFWWDDDKLV NSKNPEELME AVESMEVLIK LVKGLEDQTL TTLDQSPDLD EWSEMELTQL  180
LQDCDDVSEN DKVEEDHQTV SDKTCNNNNN NFVSVPEVEA GSLGEEKMDI DWDTFFEGLI  240
SYDDELNDEE LDQLFNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588993.10.0PREDICTED: agamous-like MADS-box protein AGL97
SwissprotQ9C6335e-41AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLA0A078GTY90.0A0A078GTY9_BRANA; BnaC06g02840D protein
TrEMBLA0A0D3CPL00.0A0A0D3CPL0_BRAOL; Uncharacterized protein
STRINGBra018727.1-P1e-110(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49420.13e-44M-type_MADS family protein