PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 279aa    MW: 31137.9 Da    PI: 4.4634
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588961.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.51.8e-134583139
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                    k+i nk  r +tfskRr g+  KA  L+vL da++a++ 
  XP_013588961.1 45 KKITNKASRATTFSKRRDGLYSKAAQLCVLSDAQIAILA 83
                    689*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.2733788IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-153798IPR002100Transcription factor, MADS-box
CDDcd002662.19E-1938118No hitNo description
SuperFamilySSF554554.06E-1739113IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-93959IPR002100Transcription factor, MADS-box
PfamPF003192.0E-134687IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-95974IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-97495IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
METWMGAHHE KRTPQSLVVT IGQAHKFRVK KRMVKGGTKR KPEMKKITNK ASRATTFSKR  60
RDGLYSKAAQ LCVLSDAQIA ILATPSSSSN SNASFFSFGH SSVESVVSAY LAGQRLPPVS  120
SSRDTREDLG ICMARKDLGL GFWWDDDKLA NSKNPEELME AMESMKVLMS HLKGLEDQTL  180
STVDQSPDLD EWSEMELTQL LQDCDDVPPP PPLVSNTDKE EEDQTVSDNN NNNSVSSLPA  240
AAEKSLEEVT MDLDFDTIFE GLLSYDDEDL FWSDDLLFM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588961.10.0PREDICTED: agamous-like MADS-box protein AGL97
SwissprotQ9C6331e-41AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLA0A0D3CP750.0A0A0D3CP75_BRAOL; Uncharacterized protein
STRINGBra018727.1-P1e-135(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49420.12e-44M-type_MADS family protein