PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588568.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family FAR1
Protein Properties Length: 269aa    MW: 30813.8 Da    PI: 6.1922
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588568.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR194.41.4e-29104191291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+sk ++s+++g+ + r++vC+keg+r ++k++  k  r+raetr+gC+a++ ++ke++gkw++tk+++eHnH+l+p
  XP_013588568.1 104 FYNAYATKVGFVIRVSKLSRSRHDGSPIGRQLVCNKEGYRLPNKRD--KVIRQRAETRVGCRAMILIRKESSGKWVITKFVKEHNHPLMP 191
                     9******************************************999..999************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.9E-27104191IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MIATCNGVHL LELLLLAVDF RIDNGDAAAG MMMGHNEMGE SSGQAMIEQD EENHNEIGEH  60
SGEEMTLEQD EKVDPDSIPL EVADMADEPF VGQEFESEAA AHGFYNAYAT KVGFVIRVSK  120
LSRSRHDGSP IGRQLVCNKE GYRLPNKRDK VIRQRAETRV GCRAMILIRK ESSGKWVITK  180
FVKEHNHPLM PGRVRRGCIY DQYPNEHDKI QELMQQLAAE KKRAATYKRH LEMLFDHIEQ  240
HNEGLTKRIQ HIVDNVRDLE QRDRQQNQV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013588568.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0580890.0AY058089.1 Arabidopsis thaliana AT3g59470/T16L24_20 mRNA, complete cds.
GenBankAY1430810.0AY143081.1 Arabidopsis thaliana At3g59470/T16L24_20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588568.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1
TrEMBLA0A0D3CUT00.0A0A0D3CUT0_BRAOL; Uncharacterized protein
STRINGBo6g076470.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73022539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-156FAR1 family protein