PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588208.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 207aa    MW: 23533 Da    PI: 9.3671
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588208.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.17.1e-1121541346
                    HHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF 13 fskRrngilKKAeELSvLCdaevaviifsstgkl 46
                    +  R +++lKKA+ELS LC+++v++i f  +g+l
  XP_013588208.1 21 YKARVATVLKKAFELSELCGVNVCIIWFDREGNL 54
                    456999**********************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.66E-112097IPR002100Transcription factor, MADS-box
PROSITE profilePS500668.9982161IPR002100Transcription factor, MADS-box
PfamPF003197.1E-82254IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MKKLSVRKET TLFKKPSSSL YKARVATVLK KAFELSELCG VNVCIIWFDR EGNLVKTCPE  60
NEEAKVRAMA ERYSMLSEQE RNKKSTNLSG FLNKKMMDDK KESLKKKDNK FSGKVSEFMD  120
SLQSRFQTLQ ESLFLVDQQP KEASAVVSTD LSSNHPSTTT TSLSKMKVGT FGIICCYLLY  180
ASLTKTHYCD QSIAWSDQQN GKYSEHD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.150510.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588208.11e-153PREDICTED: agamous-like MADS-box protein AGL93
SwissprotQ7X9N22e-27AGL53_ARATH; Agamous-like MADS-box protein AGL53
TrEMBLA0A078JR448e-95A0A078JR44_BRANA; BnaCnng56720D protein
TrEMBLA0A0D3CP762e-94A0A0D3CP76_BRAOL; Uncharacterized protein (Fragment)
STRINGBra004071.1-P1e-61(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15639717
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G27090.11e-25AGAMOUS-like 54