PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 444aa    MW: 49754.9 Da    PI: 6.1017
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588130.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS505.71.9e-154534411374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA++v+sg+l++a+a+L++ls l+spdgd+mqR+aayfteALa+r+++s+++lykal++++ +++n+see+++++lf++++Pilk+s+
  XP_013588130.1  53 LIHLLLTCANHVASGSLQNANAALEQLSLLSSPDGDTMQRVAAYFTEALANRILKSWPGLYKALNATQRKTNNVSEEVHVRRLFFDMFPILKVSY 147
                     689******************************************************************************************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     l++N+aIlea+ege++vH+iD+d+s+++QW+aL+q ++sRpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+fn+ v+++le+l+
  XP_013588130.1 148 LLTNRAILEAMEGEKMVHVIDLDASEPAQWLALIQDFNSRPEGPPHLRITGVHH----HKEVLDQMAHILTEEAEKLDIPFQFNP-VVSSLESLN 237
                     ******************************************************....9**************************.799****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll..................desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                     +++L vk+gEalaV++vlqlh++l                  ++s++l++  +++++L++++slsPk++vv+eq++dhn+++++er+le+l++y+
  XP_013588130.1 238 IDQLGVKTGEALAVSSVLQLHNFLasdedilrkngyslsgdsASSLPLPNsgRISRFLNAMWSLSPKIMVVTEQDSDHNGSTLMERLLESLYTYA 332
                     ****************************************997777777777999**************************************** PP

            GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                     alfd+leak+pr+ ++r+kvE++++g+ei+n++aceg+errerhe+lekW++r++ aGF++vpls++a+ q ++ll+ +++dgy+++eesg++v+
  XP_013588130.1 333 ALFDCLEAKVPRTCQDRSKVEKMFFGEEIKNIIACEGSERRERHEKLEKWSQRIDLAGFGNVPLSYFAMLQGRRLLQGYGFDGYMIKEESGCAVI 427
                     *********************************************************************************************** PP

            GRAS 361 gWkdrpLvsvSaWr 374
                     +W+drpL+svSaWr
  XP_013588130.1 428 CWQDRPLYSVSAWR 441
                     *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.40727421IPR005202Transcription factor GRAS
PfamPF035146.5E-15253441IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MVVAMLQEDN GTSSVASSPL QVFSTMSLTR PALLSSPSSP FKDLKPEERG LYLIHLLLTC  60
ANHVASGSLQ NANAALEQLS LLSSPDGDTM QRVAAYFTEA LANRILKSWP GLYKALNATQ  120
RKTNNVSEEV HVRRLFFDMF PILKVSYLLT NRAILEAMEG EKMVHVIDLD ASEPAQWLAL  180
IQDFNSRPEG PPHLRITGVH HHKEVLDQMA HILTEEAEKL DIPFQFNPVV SSLESLNIDQ  240
LGVKTGEALA VSSVLQLHNF LASDEDILRK NGYSLSGDSA SSLPLPNSGR ISRFLNAMWS  300
LSPKIMVVTE QDSDHNGSTL MERLLESLYT YAALFDCLEA KVPRTCQDRS KVEKMFFGEE  360
IKNIIACEGS ERRERHEKLE KWSQRIDLAG FGNVPLSYFA MLQGRRLLQG YGFDGYMIKE  420
ESGCAVICWQ DRPLYSVSAW RCRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-69364431380Protein SCARECROW
5b3h_D9e-69364431380Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013588130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893010.0AC189301.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030D08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588129.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_013588130.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A078HGZ10.0A0A078HGZ1_BRANA; BnaC06g03620D protein
STRINGBo6g022200.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]