PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013587706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 383aa    MW: 43470.9 Da    PI: 7.7605
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013587706.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.9e-32211264255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_013587706.1 211 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 264
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15208264IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28209264IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23211264IPR006447Myb domain, plants
PfamPF002492.5E-7212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSQ PSSTWQRRRP TTDQEDHEEL DLGFWRRALD SRTSSLVSNS  60
SSKTTNNHHH HPLEDRSLSN NSHRHQQQHP HLLPNCNGSN IFTSFQFPTQ QQQHLQGFLA  120
HDLNTHLRPI RGIPLYQNPP PHHHHRPPPC FPFDPSSLIP SSSPTPTGIN NNSFGTSRVN  180
PNHHNHQHHH QTLNRARFMP RFPAKRSMRA PRMRWTTTLH ARFVHAVELL GGHERATPKS  240
VLELMDVKDL TLAHVKSHLQ MYRTVKTTDK AAASSEQSDV YENGSSGDNN SDDWMFDMNR  300
KSRDSDELTN PLEKSNGRWT NSSGEARLHG KLIDNVAEII LPSENEIDGK SSSYERISSE  360
EMSSSNISGT SPFKPNLEFT LGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934910.0AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587706.10.0PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A078EP510.0A0A078EP51_BRANA; BnaC05g24390D protein
STRINGBra023254.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-157G2-like family protein