PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013587689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 677aa    MW: 74644.1 Da    PI: 7.0254
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013587689.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.32.3e-16388426240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+N+ 
  XP_013587689.1 388 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNRP 426
                     689**********************************75 PP

2TCR52.87.9e-17473512140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN  
  XP_013587689.1 473 RHKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNAF 512
                     589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.4E-19387428IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543388513IPR005172CRC domain
PfamPF036385.6E-12390425IPR005172CRC domain
SMARTSM011145.7E-17473514IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-12475511IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MDNSQKKKIE TPTPKSKFED SPVFNYINNL SPIEAVRSIP TVQTFNSLSF TSPPPVFTSP  60
HASFHRESRF FRCHNSVERS KALESLDRSV STQEEVVVAS GEVDLNKEAT LEDQEEDETS  120
RDRVDSPGTG DIVTQVLLDP SGVAPQGEDN ASSSEDVSVG LRKILDAQKE NDTPGCRRLM  180
ADAAELLVFR SPNDSEAFGC LVDKISSSER RFCAGVKLTK RHDITKDVQA NDNQPLAVVP  240
NQSVSNLHRG SMRRRCLDFE VLGKRKKDIA DDDQQAVGDN KAESSSKCVV PGIGLHLNAI  300
AMASRGIKIN TIHEDSATVE IQKSFLGSTT PVQSQDIMRE TLDQAENEPG KGLAVEEETP  360
KPLVFEELNQ DSLQKKKRKV EEPGEGDSCK RCNCKKSKCL KLYCECFAAG VYCIEPCSCV  420
DCFNRPIHED TVLATRKQIE SRNPLAFAPK VIRNSDSIME TTDDASKTPA SARHKRGCNC  480
KKSNCLKKYC ECFQSGVGCS INCRCEGCKN AFGKKDAYLL AIMESKQEED LSKVQQNPNL  540
SKEVEQNPSS DQPSTPLPPY RHTVVHQPFL SKNRLPPTQF FLGAGSSSFR KPDGDLTQAR  600
NEKKPLETVA EDKTEIMPEI LSNTPITTIK AISPNSKRVS PPHIGSSESG PIIGKRTNGR  660
KLILRSIPAF PSLNPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1639251014120Protein lin-54 homolog
5fd3_B2e-1639251014120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252266RRRCLDFEVLGKRKK
2374379KKKRKV
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013587689.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587689.10.0PREDICTED: CRC domain-containing protein TSO1
RefseqXP_022557925.10.0CRC domain-containing protein TSO1-like
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078IU520.0A0A078IU52_BRANA; BnaCnng27630D protein
TrEMBLA0A0D3CH360.0A0A0D3CH36_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EKS80.0A0A3P6EKS8_BRAOL; Uncharacterized protein
STRINGBo5g094500.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]