PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013587026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family VOZ
Protein Properties Length: 483aa    MW: 53940.6 Da    PI: 5.5288
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013587026.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ438.49.2e-1352054221217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpaqg++w+qdycssfha+la+neg+pg++pv+rp+gi+lkdgllfaalsak+ gk+vgipecegaatakspwna+el
  XP_013587026.1 205 PPPSAFLGPKCALWDCPRPAQGFDWFQDYCSSFHAALAFNEGPPGMNPVVRPGGIGLKDGLLFAALSAKAGGKDVGIPECEGAATAKSPWNAPEL 299
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelkl. 189
                     fdl++le+et+rewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelkl 
  XP_013587026.1 300 FDLTVLESETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQIMSEFGGLKRSYYMDPQPLHHFEWHLYEYEINKCDACALYRLELKLv 394
                     *********************************************************************************************73 PP

             VOZ 190 vdekksakgkvskdsladlqkklgrlta 217
                     vd+kk++kgk+s+ds+adlqk++grlta
  XP_013587026.1 395 VDGKKNSKGKLSTDSVADLQKQMGRLTA 422
                     69************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MTGKRSKITC RSASHKLFKD KAKNRVDDLQ GMLLDLQFAR KESRGVDVTL LEEQVNQMLR  60
EWKSELNEPS PASSLQQEQG GTLGSFSTDI CRLLQLCDEE DDATSKLAPP KPEPTDQNLE  120
AGKAAVFQRG YNLVQEKSEH GFSLADDHGK DPCLVVGNNF DGTAHLDYNQ YDLQQEFEPN  180
FNGGFNDCPT YGPLHISAFI PTICPPPSAF LGPKCALWDC PRPAQGFDWF QDYCSSFHAA  240
LAFNEGPPGM NPVVRPGGIG LKDGLLFAAL SAKAGGKDVG IPECEGAATA KSPWNAPELF  300
DLTVLESETL REWLFFDKPR RAFESGNRKQ RSLPDYNGRG WHESRKQIMS EFGGLKRSYY  360
MDPQPLHHFE WHLYEYEINK CDACALYRLE LKLVVDGKKN SKGKLSTDSV ADLQKQMGRL  420
TAEFPQENVN NKRCIKGRPK VNTKVAATTT GNVQNTVVEQ GNEYGVGEEF NYLVGNLTDY  480
YLP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013587026.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252560.0AB125256.1 Arabidopsis thaliana AtVOZ1 mRNA for transcription factor AtVOZ1, complete cds.
GenBankAK2270140.0AK227014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-45-I22.
GenBankAK3170060.0AK317006.2 Arabidopsis thaliana AT1G28520 mRNA, partial cds, clone: RAFL16-07-G16.
GenBankBT0202610.0BT020261.1 Arabidopsis thaliana At1g28520 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587025.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_013587026.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_013697081.10.0transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A078H0000.0A0A078H000_BRANA; BnaC05g21930D protein
TrEMBLA0A0D3CEB40.0A0A0D3CEB4_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EHD20.0A0A3P6EHD2_BRAOL; Uncharacterized protein
STRINGBo5g057050.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]