PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 523aa    MW: 58558.7 Da    PI: 5.7886
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585943.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.52.9e-08203265163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     e+e +r rr   NRe+Ar   +R++a +eeL +k++ L  eN+ L+ e +   ke ++l++ +
  XP_013585943.1 203 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLAYENENLRRETDWALKEFQSLETIN 265
                     78899*********************************************9999999998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001701.4E-7203265IPR004827Basic-leucine zipper domain
SMARTSM003384.5E-9203267IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082205268IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-6207273No hitNo description
SuperFamilySSF579592.41E-6207262No hitNo description
CDDcd147022.87E-12213259No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MSWRDTCRTL TIGGLLKAFP SFSSWLEELH SLPLVSLSLP FFFFLLLIRF FFWVQNLLFE  60
YFFLMELEPI SSCCSTSSSG EDAAANMTEL EAAEALADLA QLAVMREQVF ESAASWGSKG  120
KRVRKRVKTE SPPADSETLP TPDLAEERAV KEEGAEPISR EVTEVPVKTE TNGETPKPNL  180
ASTLRCNRPS GCGRSRQNLS EAEREERRIR RILANRESAR QTIRRRQAMC EELSKKAADL  240
AYENENLRRE TDWALKEFQS LETINKHLKE QVAKSVKPET KEPEESPKPS QVEMSTSSTT  300
PFYFYNQNPY QLFCWPHVTQ PSNPMVSPLE SQNGFTAPFT TSEGASAKAM TTQENGNPGG  360
VDNGQKTHFY VVPCPWFLPA PTDQSNGVPF TFEEPQRVVS SNGHHTDDSS TKPVEVTKTL  420
TSIKEENSGS TETRPLYDLN ESAAEVLSEE GDGFPVTTQQ QAFSFKREDV SDSPNGVTPP  480
GHRVLMSLPG KKQGSLAAAE ARKRRKELTK LKNLHGRQCR MQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1501506RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013585943.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893560.0AC189356.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585943.10.0PREDICTED: uncharacterized protein LOC106294817
TrEMBLA0A0D3CBJ00.0A0A0D3CBJ0_BRAOL; Uncharacterized protein (Fragment)
STRINGBo5g027510.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-174bZIP family protein