PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 334aa    MW: 36961.9 Da    PI: 8.0574
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584995.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.69.1e-151050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i n+  r+ t+ kR++g+lKK +ELS+LC++ +  ii+s+
  XP_013584995.1 10 FILNNASRKATYKKRKKGLLKKVHELSTLCGIPAGAIIYSP 50
                    788999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.694149IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-21160IPR002100Transcription factor, MADS-box
CDDcd002662.42E-17285No hitNo description
SuperFamilySSF554553.27E-22295IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-8323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-151051IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MTRKKVKLAF ILNNASRKAT YKKRKKGLLK KVHELSTLCG IPAGAIIYSP YDPTPEVWPD  60
ADGIQQVIAA FRSLPELERH KNMVNQEEYL KQRIEKAGKI LKKQTRDNRE VHFTEVMYQC  120
LMGNMGVAGA RAMDLNDLGF LIDQYLNCLD RRIETLLGSS NMEIGESSNA VAAMDQDPSE  180
PAGTLPLVEG ATAPAPAVNG VGSSSSSAAA GGGASFNQMY PFPQNQQMFY QPSAPFAGYY  240
EQPPRQNQFM EMMNRPEHMQ AYAANQMGFP FMENAHHYRQ PNQPQPQQFF PGESSAAPQR  300
PFFPGESSAP PPPGTSGSEP PATAPYPPNN IWFR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFILNNASRKATYKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6084923e-40AB608492.1 Raphanus sativus DNA, microsatellite locus RsSH024, cultivar: rat-tail radish.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584995.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D3CMG80.0A0A0D3CMG8_BRAOL; Uncharacterized protein
STRINGBra041022.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-77AGAMOUS-like 80