PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 573aa    MW: 62674.9 Da    PI: 8.2589
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584927.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.7e-16294332240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCk+skClk+YCeCfaag++C   C+C dC+Nk 
  XP_013584927.1 294 SCKRCNCKRSKCLKLYCECFAAGVYCIGPCSCVDCFNKP 332
                     689**********************************96 PP

2TCR52.41e-16380418139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  XP_013584927.1 380 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 418
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.3E-18293334IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.385294420IPR005172CRC domain
PfamPF036389.8E-12296331IPR005172CRC domain
SMARTSM011144.2E-17380421IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-12382418IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MDTPPKNVTQ MENPISKLKL ENSPVFNYIN SLSPIKPVRS LPIAQTFGSL SYSSPPSVFT  60
SPHVSSHKGS RFKSDHNHVP TSVGEDEALR ETEPPQILQN ECTTDLLKMC DGNVKQKSET  120
PDWDAMISDS SDILILDSVN DSEASRCFLE RPSDSKTRSL GVAKSTLEPL MNIDDALHRG  180
VRRRCLGFEQ TPVASSSRCA VPSIGLHFNT IAMSSNDNNV GNEYSLSGNI KVGLQSSITS  240
VLNSQDNVGV SETGEDAGQG VEEGPKSLAL VELNQSSPKK KRRKFGQAGE GESSCKRCNC  300
KRSKCLKLYC ECFAAGVYCI GPCSCVDCFN KPIHEDTVMA TRKQIESRNP LAFAPKVIGN  360
SDSIMEVGDD AKSKTPASAR HKRGCNCKKS NCLKKYCECY QSGVGCSINC RCEGCKNAFG  420
RKDVSAGSSF TSMDKENETS SRGRTEKQPS TPMPLRQPLA QLPISSNNML LTHQHLHGAS  480
GSSLHMSQSF RRQDMSLMSH SKIEIITEER RADNIENLIE SPMTNMINAL SPNSKRLSLP  540
HVVGSSELSP WRRNGGRKLL LSIPTFPSLT PHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1629641712120Protein lin-54 homolog
5fd3_B1e-1629641712120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1278282KKKRR
2278283KKKRRK
3279283KKRRK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013584927.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584927.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
RefseqXP_013695714.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A3P6EYZ90.0A0A3P6EYZ9_BRAOL; Uncharacterized protein
STRINGBo5g094510.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]