PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 295aa    MW: 33826.4 Da    PI: 9.6989
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584440.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.41e-126742596
                    TT......---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 25 eh......ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    +h      +g+   +  ++l++  s  +Wevk+  ++++    lt+GW+eF  +++L++gD+v+F++dg+  f  +v+ 
  XP_013584440.1  6 KHikgttnEGN--ANAVVKLRSdASDLTWEVKM--DGRR----LTQGWQEFTTSHDLRVGDIVIFRHDGDLLF--HVTT 74
                    55554443444..3345777765888*******..9998....***********************8875444..6665 PP

2B364.91.2e-20117209498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     + +++ +l+++ l lp+ f +++g+ ++e+ ++ l +e g+ W+  l+y kk g ++l++GW++F+++n+ +++D ++Fkl++ +++++v+++++
  XP_013584440.1 117 ARVTPANLRKNTLFLPRGFSRSNGLMNREG-EIFLLNEYGKPWTALLSYYKKTGDVYLRRGWRNFCHENQKRANDLLTFKLVQ-EGTKPVLQLCS 209
                     56788999999************8887665.9*************************************************98.89999**9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.984178IPR003340B3 DNA binding domain
SMARTSM010191.5E-5378IPR003340B3 DNA binding domain
SuperFamilySSF1019364.32E-141585IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-161786IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-71967IPR003340B3 DNA binding domain
CDDcd100177.03E-92075No hitNo description
Gene3DG3DSA:2.40.330.101.9E-20108210IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-22110212IPR015300DNA-binding pseudobarrel domain
CDDcd100177.56E-21114209No hitNo description
PROSITE profilePS5086314.043114210IPR003340B3 DNA binding domain
SMARTSM010193.6E-25115211IPR003340B3 DNA binding domain
PfamPF023629.1E-20116209IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.0E-10214288IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-9221288IPR015300DNA-binding pseudobarrel domain
CDDcd100172.99E-8224288No hitNo description
SMARTSM010190.55224295IPR003340B3 DNA binding domain
PROSITE profilePS508637.542224295IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTFYSKHIKG TTNEGNANAV VKLRSDASDL TWEVKMDGRR LTQGWQEFTT SHDLRVGDIV  60
IFRHDGDLLF HVTTFGPSCC EIQYDDDVFQ ISSDSDSEMN QETREAVSPS DKSCFVARVT  120
PANLRKNTLF LPRGFSRSNG LMNREGEIFL LNEYGKPWTA LLSYYKKTGD VYLRRGWRNF  180
CHENQKRAND LLTFKLVQEG TKPVLQLCSS MYNRGSSSTS EDRFLTLTLT HYNFKKCKLC  240
LPATFLKANG IKSARKITLV DRYGIKRTTS LKPDNNYGRM RVGKGWRESS VKLME
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584440.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
TrEMBLM4EM721e-173M4EM72_BRARP; Uncharacterized protein
STRINGBra029892.1-P1e-172(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.14e-70B3 family protein