PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013583896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family FAR1
Protein Properties Length: 214aa    MW: 24499.1 Da    PI: 10.1043
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013583896.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR194.81e-2943131190
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +fY++YAk++GF +r+++ ++s r+g++++r++vC+keg+r+++ ++ +++r++ra tr gCka ++vkk+k+gkw vtk+++eHnH+l 
  XP_013583896.1  43 SFYDSYAKSTGFVMRVDAFRRSMRDGTVVWRKLVCNKEGFRRSRPRR-SESRKPRAITREGCKALIVVKKDKSGKWIVTKFVKEHNHPLL 131
                     5********************************************99.9***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.6E-2843131IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MEGNLLRGKD VVETMENIVT EEASSVVEPF IGMEFESEEA AKSFYDSYAK STGFVMRVDA  60
FRRSMRDGTV VWRKLVCNKE GFRRSRPRRS ESRKPRAITR EGCKALIVVK KDKSGKWIVT  120
KFVKEHNHPL LSLLANARRS SHISQSPDEK DAKIRELSTE LSRERKRCAA LQQQLDMVLN  180
VMEEHANHLS VNINNVIQSV KEIESITFTK SLIS
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013583896.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013583896.11e-157PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_013696015.11e-157protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL83e-29FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A3P6FXQ41e-154A0A3P6FXQ4_BRAOL; Uncharacterized protein
STRINGBo5g141470.11e-145(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135242227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.11e-104FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]