PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013583413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 349aa    MW: 39835.4 Da    PI: 10.0446
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013583413.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.87.9e-1330813187
                    .--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3 31 eesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                      ++ l+l++  s ++Wevk+  ++++    lt+GW++F++ +g+++gD+v+F++dg+
  XP_013583413.1 30 SHDFLLKLTSdASDKTWEVKM--DGRR----LTRGWQNFANGHGVRVGDIVIFRRDGD 81
                    45567777775889*******..9998....***********************6653 PP

2B354.52.1e-17131225398
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      + +++++l++++l +p++f +++g+  +e  +++l +e g+ W++ l+  + ++g++++++GW++F+++n+ +++  ++Fkl++  ++++v+++
  XP_013583413.1 131 VARVTASNLSRDMLFFPRDFSRSNGLMDRE-CEIILLNEYGKPWKLFLRNhKTHGGGVYIRTGWRRFCRQNRKRVNSLLTFKLVQ-AGTKPVLQL 223
                     5668999*****************777544.59***************663555555**************************98.788899999 PP

                     E- CS
              B3  97 fr 98 
                     ++
  XP_013583413.1 224 CS 225
                     97 PP

3B352.96.6e-17249336190
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f++ +++ ++l+++ l+lp kf+  +g+++++  ++tl d+ g + +  l+ ++k g++ ++kGW+eF+kang+k+g++++++l++++e 
  XP_013583413.1 249 FLTLTLTTYSLRKSKLCLPGKFVWLNGIENAR--KITLVDRYGVKRTTSLRPDNKYGAMRMGKGWREFCKANGVKAGESFTLELIKEEEI 336
                     66777899999************999988555..8********999999999********************************987554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-17894IPR015300DNA-binding pseudobarrel domain
CDDcd100173.68E-121289No hitNo description
SMARTSM010199.6E-111492IPR003340B3 DNA binding domain
PfamPF023628.2E-83381IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.4E-1635101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.9973592IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-18123226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.37E-19124226IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.4E-23129227IPR003340B3 DNA binding domain
PROSITE profilePS5086313.14129226IPR003340B3 DNA binding domain
CDDcd100171.83E-17129225No hitNo description
PfamPF023621.8E-16131225IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-18241341IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.83E-18245342IPR015300DNA-binding pseudobarrel domain
PfamPF023626.1E-15249337IPR003340B3 DNA binding domain
SMARTSM010191.6E-19249348IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111249348IPR003340B3 DNA binding domain
CDDcd100177.06E-14259334No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MTNASASSPI NPHFFKPLLP SFQSHLVKHS HDFLLKLTSD ASDKTWEVKM DGRRLTRGWQ  60
NFANGHGVRV GDIVIFRRDG DLLFHVTSFG PSCCQILYDD DVIQVSSDSD SEKYHQDTRE  120
EGSPSDNACF VARVTASNLS RDMLFFPRDF SRSNGLMDRE CEIILLNEYG KPWKLFLRNH  180
KTHGGGVYIR TGWRRFCRQN RKRVNSLLTF KLVQAGTKPV LQLCSSMYNR DSLRGSSSSS  240
SSSRSQERFL TLTLTTYSLR KSKLCLPGKF VWLNGIENAR KITLVDRYGV KRTTSLRPDN  300
KYGAMRMGKG WREFCKANGV KAGESFTLEL IKEEEINTST HLLKFCTEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013583413.10.0PREDICTED: B3 domain-containing protein REM10-like
RefseqXP_013751803.10.0PREDICTED: B3 domain-containing protein REM10-like
TrEMBLA0A078EIL80.0A0A078EIL8_BRANA; BnaC05g42080D protein
TrEMBLA0A0D3CLA20.0A0A0D3CLA2_BRAOL; Uncharacterized protein
STRINGBra029892.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.12e-77B3 family protein