PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00158450001
Common NameGSBRNA2T00158450001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 1242aa    MW: 137168 Da    PI: 7.1459
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00158450001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.51.7e-15301339240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                           +k+C+CkkskClk+YCeCfaag++C e+C+C dC Nk 
  GSBRNA2T00158450001 301 ACKRCHCKKSKCLKLYCECFAAGVYCLESCSCVDCYNKP 339
                          589**********************************96 PP

2TCR48.51.7e-15387426140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+gCnC+ks+C+kkYCeC+++g+ Cs +C+Ce+CkN  
  GSBRNA2T00158450001 387 RHKRGCNCRKSNCVKKYCECYQSGVGCSINCRCEGCKNAF 426
                          589***********************************75 PP

3TCR49.96.1e-16953991240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  GSBRNA2T00158450001 953 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 991
                          689**********************************96 PP

4TCR51.12.6e-1610391077139
                  TCR    1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39  
                           ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  GSBRNA2T00158450001 1039 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 1077
                           589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-16300341IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.335301427IPR005172CRC domain
PfamPF036382.1E-11303338IPR005172CRC domain
SMARTSM011143.3E-16387428IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.8E-11389425IPR005172CRC domain
SMARTSM011142.4E-19952993IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.3949531079IPR005172CRC domain
PfamPF036381.5E-11955990IPR005172CRC domain
SMARTSM011144.2E-1710391080IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-1110411077IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1242 aa     Download sequence    Send to blast
METPQKTIIQ NGTPVSKLKN SPVFNYINNL SPIKPVRLIP IAQTFGSLSP SVYTPPHKGS  60
RFKSHTYFSD PSKELVEEAL LETIPPEILK NDCISTPPRR AAANDGSCGD GETDLQRMCD  120
GNVKRKSDTP DWETQFPDTP EMLIYDTLND SEADRCFLPA SSDSKRRSCG GTKPRLEPVS  180
NSKELADSLH RGVRRRLLDF EMPYKQTSEK SSSSCVVPPS TVLHLNAFAM SFKDINVGNE  240
YSLSGNIKAG LQKFENETGE AAGQSVVEEV QKSSLALVEM NQSSPKKKRL KSGQAGEGES  300
ACKRCHCKKS KCLKLYCECF AAGVYCLESC SCVDCYNKPI HEDIVLATRK QIESRNPIAF  360
APKVIRNTDS SIMEAGVDAS KTPASVRHKR GCNCRKSNCV KKYCECYQSG VGCSINCRCE  420
GCKNAFGKKD VSSFVGMDIK QDDVSETWKT QQNNELVRYV PLPPSTPMLL RQPLAQLPIS  480
SNNMLLPQQS QHLHGASGSS LYESQSFRKQ GTSLLSHSRT EKIIEDIENL IQSPITNINA  540
VSPNSKRVSL PHLDSPELTP RRRNAAWKMD NENSQKEPAS KIETPTPKSK FEDSPVFNFI  600
NNLSPFEPVK SFSSAQTFSS LSFTSPPPVF ASPHPNFHRE SRFFRCQHSV DRSKALGDGS  660
VSKEDREVDL NKDATLEDDE EEDTETSCEL PQILSSDGQS PPHHGEDIVT QTLLPPSDPP  720
LGEDNNGSSM NRLQKIPDSQ EEENGTPDSR RLMADAAAEL LVFRSPNDSE AFTCLVDKIS  780
SSERRFFAGV KHHDIIPANG SSNDNEPLAV VPNQLVSNVH CGSMRRRCLD FEVPGKRKKD  840
DDQQTVCDNN KPESSSSKCV VPGIGLHLNA IAMASSNTKI SITHEYSSSE EVQNTFSGSI  900
TPVHSQDTVP ETLDQAESQP GEEAPKALVF EELIPDSFQK KKQVLEGGEG ESSCKRCNCK  960
KSKCLKLYCE CFAAGVYCIE PCSCVDCFNK PIHEDTVLAT RKQIESRNPL AFAPKVIRNS  1020
DSSIMDTSDD ASKTPASARH KRGCNCKKSN CLKKYCECYQ SGVGCSINCR CEGCKNAFGR  1080
KDAYLHTIME SKQEDDHETY EKRTEKIQQN SKEVEQNPQP STPLPPYRNL VVHQPFLSRN  1140
KLPPTQFFLG AGSSSFRKPD CDVTQSMNEK KSLETVTEDK TEIMPDILNT SPIKANSPNS  1200
KRVSPAHIGP SEPGSILGKR SNGRKLILRS IPAFPSLNPN Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-16305107614120Protein lin-54 homolog
5fd3_B1e-16305107614120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1824838RRRCLDFEVPGKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00158450001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013719668.10.0CRC domain-containing protein TSO1-like isoform X1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A3P6AAR70.0A0A3P6AAR7_BRACM; Uncharacterized protein
STRINGBra001884.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  4. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]