PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00156641001
Common NameGSBRNA2T00156641001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 339aa    MW: 37969 Da    PI: 8.0859
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00156641001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32167220255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSBRNA2T00156641001 167 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 220
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-15164220IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28165220IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-23167220IPR006447Myb domain, plants
PfamPF002492.1E-7168219IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSQ PSSTTSSLVS NSSSKTTNNH HHPLEDLSLS NNSHRHHQQI  60
FTSFQFPTQQ QQHLQGFLAH DLNTHLRPIR GIPLYQNPPP HHHHRPPPCF PFDPSSLIPS  120
SSPTPTGINN NSFGTSRVYP NHHNHHQTLN RARFMPRFPA KRSMRAPRMR WTTTLHARFV  180
HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKAAAS SGQSDVYENG  240
SSGDNNSDDW MFDMNRKSRD TDELTNPLEK SNGRWTNSSG EARLHGKLID NVAEIILPSE  300
NEIDGKSSSY ERMSSEDMSS SNISGTSPFK PNLEFTLG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00156641001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934910.0AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009114900.10.0PREDICTED: probable transcription factor KAN2 isoform X1
RefseqXP_013731603.10.0PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6161e-160KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A078DY600.0A0A078DY60_BRANA; BnaA09g24470D protein
STRINGBra023254.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-128G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]