PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155741001
Common NameGSBRNA2T00155741001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 268aa    MW: 30018.3 Da    PI: 10.0389
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155741001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.68.7e-11143186548
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                          kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  GSBRNA2T00155741001 143 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPR 186
                          899********************************998777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-13139203IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588141193IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.55E-11143197No hitNo description
Gene3DG3DSA:1.20.5.1702.1E-13143194No hitNo description
PfamPF001702.3E-9143187IPR004827Basic-leucine zipper domain
CDDcd147031.33E-21144194No hitNo description
PROSITE patternPS000360146161IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MAQLPPKIPT MTTTTTPHWP DFSSQKLPSI AATAAATFLD FSSTRRGTHR RSISDSIAFL  60
EAPSSGVGNH HFDRFDDEQF MSMFNDDVHQ NHHNNNHNNH HGSVNGNVDE VQSQCKTEPQ  120
DGAPSSANQN SGGSSGNRIN DPKRVKRILA NRQSAQRSRV RKLQYISELE RSVTSLQTEV  180
SVLSPRVAFL DHQRLLLNVD NSAIKQRIAA LAQDKIFKDA HQEALRREIE RLRQVYHQQS  240
LKKMENNVSD QSPADIKPSV EKKQLNA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155741001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4013001e-170AF401300.1 Arabidopsis thaliana transcription factor bZIP61 (BZIP61) mRNA, complete cds.
GenBankAY0873561e-170AY087356.1 Arabidopsis thaliana clone 34553 mRNA, complete sequence.
GenBankAY0930531e-170AY093053.1 Arabidopsis thaliana pelota-like protein (At3g58120) mRNA, complete cds.
GenBankBT0087281e-170BT008728.1 Arabidopsis thaliana At3g58120 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104108.11e-152PREDICTED: basic leucine zipper 61-like
RefseqXP_013648365.21e-152basic leucine zipper 61-like isoform X1
RefseqXP_022572083.11e-152basic leucine zipper 61-like
SwissprotQ9M2K41e-139BZP61_ARATH; Basic leucine zipper 61
TrEMBLM4CT381e-155M4CT38_BRARP; Uncharacterized protein
STRINGBra007380.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-91bZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]