PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155138001
Common NameGSBRNA2T00155138001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 196aa    MW: 21785.3 Da    PI: 5.5971
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155138001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.1e-1977137257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          r+R+t+t+ ql++Le+ +e+ + +p+ +++ee++ +l    ++ +++V++WFqNrRa+ k+
  GSBRNA2T00155138001  77 RHRWTPTSMQLQILESIYEEgSGTPKPQRIEEITLELsqhgQVMDKNVYNWFQNRRARSKR 137
                          89*****************99**************************************97 PP

2Wus_type_Homeobox1024.3e-3376139265
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          +r+RWtPt+ Q++iLe++y++G  tP+ ++i++it eL+++G+++dkNV++WFQNr+aR+++kq
  GSBRNA2T00155138001  76 HRHRWTPTSMQLQILESIYEEGSGTPKPQRIEEITLELSQHGQVMDKNVYNWFQNRRARSKRKQ 139
                          589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.14E-1670144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-1571145IPR009057Homeodomain-like
PROSITE profilePS5007113.13573138IPR001356Homeobox domain
SMARTSM003897.8E-1275142IPR001356Homeobox domain
CDDcd000864.84E-1277139No hitNo description
PfamPF000467.5E-1777137IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDGGSQNGAY DGRVMTEEQM EILSKQIAIY AAICRQLVSL HESLSSKLPL SSGVDPTGGG  60
YFDSMGASPS TYKISHRHRW TPTSMQLQIL ESIYEEGSGT PKPQRIEEIT LELSQHGQVM  120
DKNVYNWFQN RRARSKRKQP QAMTTTTVQT VDAVAATEER SYGDSGGFES YDHILFPSTD  180
FGIEHLLDGG IFRER*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARSKRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155138001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597183.11e-144PREDICTED: WUSCHEL-related homeobox 14-like
SwissprotQ9LM844e-95WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLA0A078DW921e-145A0A078DW92_BRANA; BnaC04g46990D protein
STRINGfgenesh1_pg.C_scaffold_10018817e-93(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.16e-94WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]