PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154828001
Common NameGSBRNA2T00154828001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 1217aa    MW: 133796 Da    PI: 7.621
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154828001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.41.9e-15294332240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+C+CkkskClk+YCeCfa+g++C  +C+C dC+Nk 
  GSBRNA2T00154828001 294 SCKRCHCKKSKCLKLYCECFASGVYCIVSCSCVDCFNKP 332
                          689**********************************96 PP

2TCR49.11.1e-15380419140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+gCnCkks+C+kkYCeC+++g+ Cs +C+Ce+CkN  
  GSBRNA2T00154828001 380 RHKRGCNCKKSNCVKKYCECYQSGVGCSINCRCEGCKNAF 419
                          589***********************************75 PP

3TCR505.9e-16932970240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C + C+C dC+Nk 
  GSBRNA2T00154828001 932 SCKRCNCKKSKCLKLYCECFAAGVYCIDPCSCVDCFNKP 970
                          689**********************************96 PP

4TCR51.12.6e-1610171055139
                  TCR    1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39  
                           ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  GSBRNA2T00154828001 1017 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 1055
                           589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-18293334IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.278294420IPR005172CRC domain
PfamPF036384.4E-11296331IPR005172CRC domain
SMARTSM011142.8E-16380421IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.3E-11382418IPR005172CRC domain
SMARTSM011141.4E-19931972IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.6929321057IPR005172CRC domain
PfamPF036381.2E-11934969IPR005172CRC domain
SMARTSM011144.2E-1710171058IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-1110191055IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1217 aa     Download sequence    Send to blast
MQNSPVFNYI NNLSPIKPVR SIPIAQTFGS LSPSVYTPPH KGSRFKSHTY FSDPAKELVE  60
EALLETVPPK ILKNNCISTP PRRAAANDGS CGNGKTDLQK MCDGNVKRKS DTPDWETQFP  120
DTPEMLIYDT LNDSEADRCF LPASSDLKRR SCGGTKPRLE PVSNSKELAD ALHRGVRRRL  180
LDFEMPDNQT SEKSSSSCVV PPSTGLHLNT AFAMSSKDTN EYSLSANIKV GLQNSTPPVL  240
HSHDILRENE TGEAAGQSVV EEIQKSSLAL VEMNQSSPKK KRLKSDQAGE GESSCKRCHC  300
KKSKCLKLYC ECFASGVYCI VSCSCVDCFN KPIHEDTVLA TRKQIESRNP IAFAPKVIRN  360
TDSSIMEAGV DASKTPASVR HKRGCNCKKS NCVKKYCECY QSGVGCSINC RCEGCKNAFG  420
KKDVSSFVGM DIKQDGESKT GQTQQNNELF SYVPLPPSTP MSLRQPLAQL PISSNNMLLP  480
QQSQQLHGAS GSFLYENQSF RKQGMGLLSR TETITEDIEN VIPSPITNIN TVSPNSKRVS  540
LPHLDPPVLT PRRRNAAWKM DNKMKNQSSA SQIETPTPKS KFEDSPVFNF INNLSPFEPV  600
KSFSSVQTFS SLSFTSPPPV FTSPHPTFHR ESRFFRCQNS VDRSKALESV SKEVDLNKDA  660
TLEDEEEDTE TSCELPQILN SDSQSPPHHG EDIVTQVLLP PSDPTPGGGN DSSSGDVKLR  720
LQEILDAQEE SGTPGSRRLM ADAAELLVFR SPNDSEAFTC LVDKISSSER RFFAGVKLPT  780
QQHDNEPLAA VPNQPISNMH RGSMRRRCLD FEVPGKRKKD DDQQTVSDNN KAESSSSTCV  840
VPGIGLHLNA IAMASRNTKI SITHEYSSSG EIQITPVPSQ DTVPEALEQA ESQPREASAV  900
EEAPKALVLE ELIPDSLQKT KQVLEGGEGE SSCKRCNCKK SKCLKLYCEC FAAGVYCIDP  960
CSCVDCFNKP IHEDTVLATR KQIESRNPLA FAPKVIRNSD SIMDTSDDAS KTPASARHKR  1020
GCNCKKSNCL KKYCECYQSG VGCSINCRCE GCKNAFGRKD AYLHAIMESK QEEDHETYEK  1080
RTADMSKEAE RNPSSEQPLT PLPPYKHLVV HQPFLPRNKL PPTQFSLGAG SSSFRKPEGE  1140
SGNEKKPLET VIEDKTEIMP DILNTSPIKA NSPNSKRVSP AHIGSSEPGS ILGKRSNGRK  1200
LILRSIPAFP SLNHNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-17298105414120Protein lin-54 homolog
5fd3_B3e-17298105414120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1804818RRRCLDFEVPGKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154828001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893270.0AC189327.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135824.10.0PREDICTED: CRC domain-containing protein TSO1-like isoform X1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A3P6AAR70.0A0A3P6AAR7_BRACM; Uncharacterized protein
STRINGBra001884.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  4. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]