PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154756001
Common NameGSBRNA2T00154756001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 559aa    MW: 60714.1 Da    PI: 8.0657
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154756001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.29.3e-15138177141
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                          ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  GSBRNA2T00154756001 138 QKKKHCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 177
                          589**************************.********986 PP

2TCR51.22.5e-16220258139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN 
  GSBRNA2T00154756001 220 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCLDCKNF 258
                          589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-17138178IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.058139260IPR005172CRC domain
PfamPF036385.9E-11140175IPR005172CRC domain
SMARTSM011147.5E-19220261IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.5E-13223258IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MFKRRGRRDA VEDEEEEEEE QNPNSEITLR KPRSMGNAGG GGKLPPKNDG GFGVPARDPA  60
TQLDLTGGSD QHSLSKPAPT VVSPAAVTSS VPSPVTVTTS RLHPVATSQS QILNAPVRLP  120
KQESPKSRPR PIVDGTPQKK KHCNCKHSRC LKLYCECFAS GTYCDGCNCV NCFNNVDNEP  180
SRRDAVEATL ERNPNAFRPK IASSPHGVRD KREEMVLLGK HNKGCNCKKS GCLKKYCECF  240
QANILCSENC KCLDCKNFDG SEERRALFHG ELANNMAYLQ QAANAAITGA VGSSGFAPYP  300
APKRRKGGQD ISFNQATTDT SPATGPSKFV YRSLLADVIQ PQDVKALCSV LVAVAGEAAK  360
ALTDKRNDNR VEDQTETSLA SSAQENSQGD VEMAEPDGNQ ADKSRRKPLS PSTLALMCDD  420
EQDTIFMVAA SEPNGSVDPS WCRTNSQGQS QDYAELERVV LTKLRDCLSR LISYAELKES  480
KRSYLARRHI QSPPSATETV KMENGIQQAP PIVNGATTQP TVNKPQLLQP MQTTTNTSST  540
HHPHKPPALP EKKDPLNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-3214026911132Protein lin-54 homolog
5fd3_B1e-3214026911132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154756001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186581e-167AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059311e-167BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596271.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_013705473.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A3P6F4W30.0A0A3P6F4W3_BRAOL; Uncharacterized protein
STRINGBo7g113450.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]