PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00151091001
Common NameGSBRNA2T00151091001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 339aa    MW: 36809 Da    PI: 7.3623
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00151091001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-1288133247
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++W +eE+  ++ + ++lG+g+W+ I+r   k+Rt+ q+ s+ qky
  GSBRNA2T00151091001  88 NPWREEEHRMFLLGLQKLGKGDWRGISRNYVKTRTPTQVASHAQKY 133
                          68*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.101.1E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.878320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.09882138IPR017930Myb domain
SuperFamilySSF466891.25E-1584139IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-1785137IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.4E-1086132IPR009057Homeodomain-like
SMARTSM007171.0E-986136IPR001005SANT/Myb domain
PfamPF002491.3E-988133IPR001005SANT/Myb domain
CDDcd001671.97E-889134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MTRRCSHCNQ NGHNSRTCPN RGVKLFGVRL TEGSIRKSAS MGNLSHHSGS GLSGLVSGSP  60
GDGPDHDGYA SEDFVPGSSS SRERKKGNPW REEEHRMFLL GLQKLGKGDW RGISRNYVKT  120
RTPTQVASHA QKYFIRQSNV SRRKRRSSLF DIVPDEIMDS QEMEAEDIPM QGSDSVPAPL  180
TLETEECESM KSTNSSGDEP PTVTASASFG SEDTIQTQLQ VQPTPGSFPV LYPAYFSPFY  240
SFPFPVWPAA PVYVTEQVKE ETHEILRPTA VHSKAAPINV DQLLGMSKLS LKESSLNGVS  300
EQSLSLKLIG GSVSRQSAFH PNPASGGGSD MNTVIHAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.129390.0flower| leaf| microspore| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00151091001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2367860.0AC236786.1 Brassica napus clone JBnB074N14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136840.10.0PREDICTED: uncharacterized protein LOC103860911
SwissprotQ2V9B05e-36MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A078DMU90.0A0A078DMU9_BRANA; BnaA03g43060D protein
STRINGBra012665.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-140MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]