PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00150876001
Common NameGSBRNA2T00150876001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 439aa    MW: 48663.8 Da    PI: 6.7515
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00150876001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09293350562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +   l+  +  l+++
  GSBRNA2T00150876001 293 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQFTLLQRDMMGLTNQ 350
                          899***************************************9999888777666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-18289353IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565291354IPR004827Basic-leucine zipper domain
PfamPF001702.8E-8293347IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.33E-11293346No hitNo description
Gene3DG3DSA:1.20.5.1704.4E-10293350No hitNo description
CDDcd147031.43E-22294343No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MGDTDTDMIH RLHSPFGKQP QQLQFSSDSA KRVGVPPTSP YSQIPTTRPQ PHGATHSRSI  60
SQPSSFFSFD SLPPLSPSPS NNNNNNNQPS SLLPPPPFTR CNSDSSRVVL PPRKSHRRSN  120
SDIPTSIPPR PLERGESPDW SNHTPPFVKK ESGEDMDDLF SAYMNLENID ALNSSEADME  180
SSRASGTKTN GSDDTEGESS SVNYESGGDR NNSLKRRAGG EGDIAPTTRH YRSVSVDSCF  240
MEKMSFGEDS LKPPPTNSVD GGIEFKNGEF NAAEMKKIMA NDKLAEMAVS DPKRVKRILA  300
NRQSAARSKE RKMRYIVELE HKVQTLQTEA TTLSAQFTLL QRDMMGLTNQ NNELKFRLQS  360
MEHQAQLRDA LSEALNGEVQ RLKLAIGETS HNESDRSKMQ SLNAEMFQQL HISQLTQQPQ  420
SQQNRNGTMS AKPESNEL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00150876001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808391e-166AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504351e-166AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656671.10.0transcription factor VIP1-like
RefseqXP_013656673.10.0transcription factor VIP1-like
RefseqXP_013656674.10.0transcription factor VIP1-like
TrEMBLA0A3P6CEH40.0A0A3P6CEH4_BRACM; Uncharacterized protein
STRINGBra010722.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]