PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00150315001
Common NameGSBRNA2T00150315001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 269aa    MW: 30500.8 Da    PI: 6.7049
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00150315001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.44.7e-16180236258
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          ++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le eN++L ke+ee + e +k
  GSBRNA2T00150315001 180 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLERENEQLLKEIEEKTRERYK 236
                          5789********************************************998777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000418.0E-5729IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1706.5E-13178239No hitNo description
PRINTSPR000418.0E-5178194IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.4E-12179244IPR004827Basic-leucine zipper domain
PfamPF001701.0E-14180238IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.208181233IPR004827Basic-leucine zipper domain
CDDcd147072.60E-16183229No hitNo description
SuperFamilySSF579596.13E-10183234No hitNo description
PROSITE patternPS000360186201IPR004827Basic-leucine zipper domain
PRINTSPR000418.0E-5196216IPR001630cAMP response element binding (CREB) protein
PRINTSPR000418.0E-5216233IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MASFKMMSSS TSRNSDLSRR NSSSASSSPT VRSNHLRRDP HADHSRISFG YGGGNDATVH  60
DYNFASDSLD VDRSNGDRNS VNGGGRKSVD DVWKEIVSGE KKTVMKEEAQ DEYMMTLEDF  120
LAQAAEMDGN DDEIDVKIPM SLSGTFDYPM MPQQNNQVEM VEGSTRRKRG RVMVEAMDKA  180
AAQRQKRMIK NRESAARSRE RKQAYQVELE TLAAKLEREN EQLLKEIEEK TRERYKNLME  240
QLIPVDDEKR KPSSSSSRSL SRSHSLEW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.139000.0seed
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00150315001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009119346.10.0PREDICTED: G-box-binding factor 4
RefseqXP_013666408.10.0G-box-binding factor 4-like
SwissprotP427771e-112GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A3P6D8C50.0A0A3P6D8C5_BRACM; Uncharacterized protein
TrEMBLM4DFK80.0M4DFK8_BRARP; Uncharacterized protein
STRINGBra015281.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.11e-102G-box binding factor 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]