PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00150182001
Common NameGSBRNA2T00150182001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 249aa    MW: 26974.1 Da    PI: 6.698
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00150182001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63e-0976122551
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          k  +r   NReA r++R++Kka+ + Le++v  L a N++L k+l+ 
  GSBRNA2T00150182001  76 KSKKRPLGNREAVRKYREKKKAKAASLEDEVMRLRAVNSQLMKRLQG 122
                          66789999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.5E-1469140No hitNo description
SMARTSM003385.7E-1072139IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.82974121IPR004827Basic-leucine zipper domain
PfamPF077169.5E-1575129IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.22E-777121No hitNo description
CDDcd146862.86E-1178130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDDGEVEFPL SSSSMDSFFD ELLRDSHACT HTHTCNPPGP ENTHTHTCLH VHTKILPAQA  60
EDKEATDDTS ESSGNKSKKR PLGNREAVRK YREKKKAKAA SLEDEVMRLR AVNSQLMKRL  120
QGQAALEAEV TRLKCLLVDI RGRIEGEIGA FPYQKPVAPN AHFSYTMQPC NNMPCGVDNN  180
LYCFQDGNSG EGALMNGQGL NGCEFDQLQC LDGDQNLAGC SNGNGTFGVN ASGVANKRKR  240
GTPASKAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.98950.0leaf| microspore-derived embryo| seed
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00150182001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622657.10.0PREDICTED: uncharacterized protein LOC106328710
RefseqXP_013685167.10.0basic leucine zipper 23
SwissprotQ8GTS21e-132BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D3BE210.0A0A0D3BE21_BRAOL; Uncharacterized protein
TrEMBLA0A3P6B6370.0A0A3P6B637_BRAOL; Uncharacterized protein
STRINGBo3g091670.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-129bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]