PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00148004001
Common NameGSBRNA2T00148004001, LOC106354548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family DBB
Protein Properties Length: 296aa    MW: 32384 Da    PI: 6.4984
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00148004001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box192.9e-06447542
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          C+ +e  e+   C  ++  lC  C ++ H        H++vpl
  GSBRNA2T00148004001  4 QCNVCEAAEAAVLCCADEAALCWACDEKVHAAnklagkHQRVPL 47
                         7******99*********************66899999999986 PP

2zf-B_box25.92.1e-085486335
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                          +kC+ ++e    +fC +++ llC++C +++H 
  GSBRNA2T00148004001 54 IPKCDICQEASGFFFCLQDRALLCRKCDVAIHT 86
                         689*******9********************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.381147IPR000315B-box-type zinc finger
CDDcd000211.08E-7347No hitNo description
SMARTSM003364.7E-10447IPR000315B-box-type zinc finger
SMARTSM003364.2E-135299IPR000315B-box-type zinc finger
PROSITE profilePS501198.8025299IPR000315B-box-type zinc finger
CDDcd000211.94E-85599No hitNo description
PfamPF006432.3E-65594IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009658Biological Processchloroplast organization
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010099Biological Processregulation of photomorphogenesis
GO:0015995Biological Processchlorophyll biosynthetic process
GO:0016607Cellular Componentnuclear speck
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MKIQCNVCEA AEAAVLCCAD EAALCWACDE KVHAANKLAG KHQRVPLSVS SSSIPKCDIC  60
QEASGFFFCL QDRALLCRKC DVAIHTVNPR VSAHQRFLLT GIRVGLECTD TGPSTKPSPS  120
NDDKTNEAKK VTLPTSEPQK MDFDHHHHQQ VVLQETNVSD HISTKLPFAS SGSAAGSIPQ  180
WQIEEIFRLT DFDQSYEYME INGSSKADTS RRGDSDSSSM MRSGGEEDGE DNNNYLGSET  240
SWAVPQIPSP PTASGLNWPK HFNHHSAVFV PDIASSTPYT GSSPNQRVGK RRRRF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.174650.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00148004001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649965.10.0PREDICTED: B-box zinc finger protein 22-like
SwissprotQ9SYM21e-167BBX22_ARATH; B-box zinc finger protein 22
TrEMBLA0A078DMK40.0A0A078DMK4_BRANA; BnaC06g39020D protein
STRINGBra035051.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56062849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.11e-144light-regulated zinc finger protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]