PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00147713001
Common NameGSBRNA2T00147713001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 184aa    MW: 20533.6 Da    PI: 8.3053
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00147713001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.73.6e-191055247
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                          ien++ r++tf kR+ gi+KKA ELS+LCd+ +av + s+ + + 
  GSBRNA2T00147713001 10 YIENETSRKTTFRKRKGGIMKKALELSTLCDVPIAVFVQSEYNSVP 55
                         59**************************************998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.19E-20168IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.044161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-23160IPR002100Transcription factor, MADS-box
CDDcd001201.54E-21258No hitNo description
PRINTSPR004045.1E-14323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-171153IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-142338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-143859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MTRNRVKMAY IENETSRKTT FRKRKGGIMK KALELSTLCD VPIAVFVQSE YNSVPELSLV  60
EKTKKMMNQE QFIQQRITKA TESCKKVAKE NKELAMKEVM YDCLRGDNAP CNLDEDELRD  120
LGGVIDQYIK GLNRRIQVLM KDHASSSTSV VPDAAAAAVA MPTAEMGSSS NVKDFDLNQT  180
QSE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00147713001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151152.11e-122PREDICTED: MADS-box transcription factor PHERES 2
RefseqXP_013647266.11e-122MADS-box transcription factor PHERES 2-like
TrEMBLA0A397Z1M11e-121A0A397Z1M1_BRACM; Uncharacterized protein
TrEMBLM4D0B51e-121M4D0B5_BRARP; Uncharacterized protein
STRINGBra009913.1-P1e-121(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.17e-48M-type_MADS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]