PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00146419001
Common NameGSBRNA2T00146419001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 308aa    MW: 33015.7 Da    PI: 7.8627
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00146419001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822189.31.5e-5821361133
               DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasas 89 
                          ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkgs+++ e++e++  sa++s
  GSBRNA2T00146419001   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEQDGTTYRKGSSRPvERMEMGIGSATTS 91 
                          5899*********************************************************************9999************* PP

               DUF822  90 pesslqsslkssalaspvesy.saspksssfpspssldsislasa 133
                          p++s + s++ss++ sp  +   +   +s +p  ++l+++s++sa
  GSBRNA2T00146419001  92 PCASFNPSPVSSSFMSPSYANlTTGDGQSLIPWLKHLSTTSSSSA 136
                          ******999999999986554033444555666666666555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.9E-543129IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEQDGTTY RKGSSRPVER MEMGIGSATT SPCASFNPSP VSSSFMSPSY ANLTTGDGQS  120
LIPWLKHLST TSSSSASSSS RLPSFMYLPG GSISAPVTPP LSSPTARGMN QINNSFFVSS  180
TPPSPTRQQT VPDSEWFAGI QLAQSVPASP TFSLVSRNPF GFREDQLASA GGGDGSRMWT  240
PGQSGTCSPA IPQTGDVPMS EAVAPPEFAF GSNANGLVKA WEGERIHEES GSDDLELTLG  300
NSSTRCN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00146419001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013650133.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
RefseqXP_013650134.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
SwissprotQ9ZV881e-161BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A078DDX60.0A0A078DDX6_BRANA; BnaA07g34330D protein
STRINGBra035060.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-143BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]