PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00145155001
Common NameGSBRNA2T00145155001, LOC106365696, STO-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family DBB
Protein Properties Length: 242aa    MW: 26860.3 Da    PI: 5.773
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00145155001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.52.3e-07443538
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                          C+ +e+ +++  C  ++  lC++C +e+H        H+
  GSBRNA2T00145155001  4 QCDVCEKAPATVICCADEAALCPKCDVEIHAAnklaskHQ 43
                         7*****************************6566676766 PP

2zf-B_box30.38.8e-105586435
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHk 35
                         ++C+ ++ek + +fC +++ llC+dC +++H 
  GSBRNA2T00145155001 55 PRCDICQEKAAFIFCVEDRALLCRDCDESIHV 86
                         79*****************************4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.172147IPR000315B-box-type zinc finger
CDDcd000212.59E-5345No hitNo description
SMARTSM003365.9E-7447IPR000315B-box-type zinc finger
SMARTSM003362.2E-165299IPR000315B-box-type zinc finger
PROSITE profilePS501199.675299IPR000315B-box-type zinc finger
PfamPF006431.4E-75595IPR000315B-box-type zinc finger
CDDcd000211.85E-85598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0048573Biological Processphotoperiodism, flowering
GO:0080167Biological Processresponse to karrikin
GO:0090351Biological Processseedling development
GO:1902448Biological Processpositive regulation of shade avoidance
GO:0005634Cellular Componentnucleus
GO:0003712Molecular Functiontranscription cofactor activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MKIQCDVCEK APATVICCAD EAALCPKCDV EIHAANKLAS KHQRLHLNSL ATKFPRCDIC  60
QEKAAFIFCV EDRALLCRDC DESIHVANTR SANHQRFLAT GIKVALSSTS CSSKNQPEPS  120
NNQQKAKEIP AKTLNQQQPS SATPLPWAVD DFFHFSDPEC TDKQKGQLGL GELEWFSDMG  180
FFGDQISQES LPAAEVPELS VSHLGHVHSY RPMKSNVSYK KPRLEFRDDD EEEHFIVPDL  240
G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.44890.0leaf| seed| vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00145155001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3869730.0JN386973.1 Brassica napus salt tolerance protein (STO-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302468.11e-180B-box zinc finger protein 24
SwissprotQ962881e-149BBX24_ARATH; B-box zinc finger protein 24
TrEMBLG9HRU71e-180G9HRU7_BRANA; BnaC08g01640D protein
STRINGBra030635.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27112767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.11e-150DBB family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]