PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00145153001
Common NameGSBRNA2T00145153001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 394aa    MW: 43435 Da    PI: 6.7547
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00145153001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1315.7e-10198254561
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  
  GSBRNA2T00145153001 198 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLSV 254
                          9*******************************************9999877666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-15194258IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749196259IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-11198252No hitNo description
SuperFamilySSF579598.44E-11198249No hitNo description
PfamPF001709.4E-9198250IPR004827Basic-leucine zipper domain
CDDcd147033.70E-23199248No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MGKEKSPSGG LPPPSPSPSP SGRYSPNGSS FAMKPESSFP PLTPSGSSSD ANRFSHDISR  60
MSDNPPKTLG HRRAHSEILT LPDDLSFDSD LGVVGAAADG PSFSDDTDED LLSMYLDMDK  120
FNSSEASSSL VGEPSEPSWR NELGSTSSER PRIRHQHSQS MDGTTSIKPE LLMSGSNEDA  180
KKRLSAAKLS ELALIDPKRA KRIWANRQSA ARSKERKMRY IAELERKVQT LQTEATSLSA  240
QLTLLQRDTN GLSVENNELK LRVQSMEQQV HLQDALNEAL KEEVQHLKVL TGQGVSNGTS  300
MMNYGSFGSN QQFYPSNQSR HTMLAAQQFQ QLQIQSQKQQ QLHQQQMYQL QQQQHIQRHE  360
QQSGATEPRR PMSSSGQKES SASPDPEATL TKD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.128694e-68microspore
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00145153001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660628.10.0probable transcription factor PosF21
SwissprotQ040881e-165POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A3P6G2K20.0A0A3P6G2K2_BRAOL; Uncharacterized protein
STRINGBo8g005940.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]