PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00144444001
Common NameGSBRNA2T00144444001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 498aa    MW: 55809.4 Da    PI: 6.4443
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00144444001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.85.5e-1391274972374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          +  L++cA+a+s++dl +a++++++l++++s +g+p+qRl ay++e+L a+la+s+s++yk+l+  +++   s+e l+++++++ev+P++
  GSBRNA2T00144444001 127 RADLVSCAQALSENDLMMAHSMMEKLRQMVSVSGEPIQRLGAYLLEGLVAKLASSGSSIYKSLNRFPEP--ASTELLSYMHILYEVCPYF 214
                          678************************************************************988887..599**************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          kf+++ aN aI ea+++e+rvHiiDf+isqG QW++L+qa+a+Rp+gpp++RiTg+++ +s   +   l+ +g+rLak+A++++vpfefn
  GSBRNA2T00144444001 215 KFGYMSANGAIAEAMKEENRVHIIDFQISQGSQWVTLIQAFAARPGGPPRIRITGIDDTTSAyaRGGGLSIVGNRLAKLAKQFNVPFEFN 304
                          **********************************************************998899999*********************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                            v+ + ++++l++L v+ gEalaVn+++ lh+++desvs+e++rd++L++vkslsPkvv++veqe+++n++ F+ rf e+++yy a+f+
  GSBRNA2T00144444001 305 S-VSVSASEVKLKDLGVRLGEALAVNFAFVLHHMPDESVSTENHRDRLLRMVKSLSPKVVTLVEQESNTNTAAFFPRFKETMDYYDAMFE 393
                          *.7999************************************************************************************ PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          s++++lpr++++ri+vE+++l+r++vn++acega+r+erhe l+kWr+r+e+aGF+++pls  +++++k+llr+++++ yr+ee++g+l+
  GSBRNA2T00144444001 394 SIDVTLPRNHKQRINVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFEMAGFTSYPLSPLVNSTIKSLLRNYSDK-YRLEERDGALY 482
                          ****************************************************************************55.*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          lgW++r Lv+ +aW+
  GSBRNA2T00144444001 483 LGWMQRDLVASCAWK 497
                          **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.616100478IPR005202Transcription factor GRAS
PfamPF035141.9E-136127497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MYKHPRQETE AYTLPPFEAN SVGKLRYIPA HNSLKRYCML EPSSSSSLVS PAYAVPSNAT  60
VNNSAYEDTS GSCVTDDFND KIKELETVMM GPDSLVFDYN DSFDSTSCQE TNSWRSTLEA  120
ISRRDLRADL VSCAQALSEN DLMMAHSMME KLRQMVSVSG EPIQRLGAYL LEGLVAKLAS  180
SGSSIYKSLN RFPEPASTEL LSYMHILYEV CPYFKFGYMS ANGAIAEAMK EENRVHIIDF  240
QISQGSQWVT LIQAFAARPG GPPRIRITGI DDTTSAYARG GGLSIVGNRL AKLAKQFNVP  300
FEFNSVSVSA SEVKLKDLGV RLGEALAVNF AFVLHHMPDE SVSTENHRDR LLRMVKSLSP  360
KVVTLVEQES NTNTAAFFPR FKETMDYYDA MFESIDVTLP RNHKQRINVE QHCLARDVVN  420
IIACEGADRV ERHELLGKWR SRFEMAGFTS YPLSPLVNST IKSLLRNYSD KYRLEERDGA  480
LYLGWMQRDL VASCAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-651304978375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.119540.0root
Bna.214110.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00144444001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525330.0AK352533.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151616.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009151615.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009151614.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009151613.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A078DDA70.0A0A078DDA7_BRANA; BnaA06g30410D protein
STRINGBra037509.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]