PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00143541001
Common NameGSBRNA2T00143541001, LOC106383049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 363aa    MW: 41615.1 Da    PI: 7.758
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00143541001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.4e-1276108335
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                          ++k +rr+++NReAAr+sR+RKka++++Le+  
  GSBRNA2T00143541001  76 PDKTQRRLAQNREAARKSRLRKKAYVQQLETSR 108
                          689**************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-574132IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.7676118IPR004827Basic-leucine zipper domain
PfamPF001702.8E-976106IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-778119No hitNo description
SuperFamilySSF579592.32E-778113No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
PfamPF141443.6E-30164239IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNTTSTHFVP PRRFEIYETT LNQVSMWEES FKNNGGIFTP NSIIIPTDAK LDSLSEDTSH  60
GTPHKFDQEA STSRHPDKTQ RRLAQNREAA RKSRLRKKAY VQQLETSRLK LIHLEQELDR  120
ARQQGFYEGN RVDTNALGFS DKMSSGIVAF EMEYGHWVEE QNRQISELRT VLQGQVSDVE  180
LRLLVDNAMK HYFQLFRMKS AAAKIDVFYI MSGMWKTSAE RFFMWIGGFR PSELLKVLLP  240
HFDPLMDQQV LDVCNLRQSC QQAEDAVSQG MEKLQHTLAD SVAAGNLGEG SYIPQITCAM  300
ERLEALVSFV NQADHLRHET LQQMHRILTT RQAARGLLAL GEYFQRLRAL SSSWATRQRE  360
PT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:8628224}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00143541001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530850.0AK353085.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-10-F22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125331.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_009125332.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_013678618.10.0transcription factor TGA4
RefseqXP_013678625.10.0transcription factor TGA4
RefseqXP_013678633.10.0transcription factor TGA4
RefseqXP_018512473.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_018512474.10.0PREDICTED: transcription factor TGA4 isoform X1
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A3P6A6G70.0A0A3P6A6G7_BRACM; Uncharacterized protein
TrEMBLM4EII90.0M4EII9_BRARP; Uncharacterized protein
STRINGBra028604.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]