PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00141208001
Common NameGSBRNA2T00141208001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 589aa    MW: 65535.7 Da    PI: 6.7495
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00141208001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.2e-093163531954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSBRNA2T00141208001 316 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 353
                          554459******************************88 PP

2BELL99.13.6e-32209275167
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkda 67 
                          erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+ + +  +
  GSBRNA2T00141208001 209 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQLKFVDHQ 275
                          79**********************************************************9877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.0E-52140273IPR006563POX domain
PfamPF075267.1E-38146270IPR006563POX domain
PROSITE profilePS5007112.26294357IPR001356Homeobox domain
SMARTSM003892.3E-9297361IPR001356Homeobox domain
CDDcd000863.16E-12297358No hitNo description
SuperFamilySSF466895.13E-17298364IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-29300363IPR009057Homeodomain-like
PfamPF059202.3E-18314353IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGSDGSL QTLILMNPTT YVQYTQQDDD SNNNNNDSNN TNNNNSFVFL  60
NSHAPPQNSS QQFIGIPLSG HEAASITSAD SISTPRAHQG LFLTLSSQQQ QQQHQNQHQT  120
FHHVGLGSGP GQDMWVGSGS TGIATLVSPK YLEAAQELLD EVVKADSNDI NTRSQLFSSK  180
KGTTETDNKA VGESSTASEK NKVELGTVER QEIQMKKAKL SSMLHEVEQR YRQYHQQMQM  240
VISSFEQAAG IGSAKSYTSL ALKTISRQLK FVDHQLRQQR ALQQLGMIQH HPSNNAWRPQ  300
RGLPERAVSV LRAWLFEHFL HPYPKDSDKH MLAKQTGLTR SQVSNWFINA RVRLWKPMVE  360
EMYVEEMKEQ GKNMGSMEKT PNLDQNNEDS ASKSASNQEK SPIGGRGVDN YHLNPNQNGE  420
LEGVTGMQGS PKRLRTNEET MMQPNVDFTS NEKLTMKILE ERQEIRSDGG YPFMGNFGQY  480
QMDEMSRFDV AVSDQELLAQ RYSGNNNGVS LTLGLPHCDS LSSTRHQGFM QTHHGIPIGR  540
RVKIGETEEY GAANISAATV HSSAAAYSAM NIQNQKRYVA QLLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16303361563Homeobox protein Meis2
3k2a_B1e-16303361563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.244221e-130flower| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00141208001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893800.0AC189380.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB050K06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636675.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X2
RefseqXP_013636676.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X2
RefseqXP_013636677.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X2
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A078D4A00.0A0A078D4A0_BRANA; BnaC04g09330D protein
STRINGBra005310.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]