PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00138854001
Common NameGSBRNA2T00138854001, LOC106443683
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 227aa    MW: 26087 Da    PI: 9.5895
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00138854001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-19666257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         ++R+++t+eql +Lee+++   r+p+a ++++++++l    +++ ++V++WFqN++a++++
  GSBRNA2T00138854001  6 STRWCPTTEQLMILEEMYRTgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
                         58*****************99*************************************996 PP

2Wus_type_Homeobox118.72.6e-38567264
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                         a+tRW+Pt+eQ++iLee+y++G+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
  GSBRNA2T00138854001  5 ASTRWCPTTEQLMILEEMYRTGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
                         589***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0022471IPR001356Homeobox domain
PfamPF000463.8E-17766IPR001356Homeobox domain
CDDcd000862.80E-4767No hitNo description
SuperFamilySSF466891.03E-10767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-7866IPR009057Homeodomain-like
PROSITE profilePS500719.7661267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSPVASTRWC PTTEQLMILE EMYRTGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH  60
KARDRQKLRK KLAKQLHQQQ LQQIKLKPIS MVSEPLNNII DHHNLYYHNH HRPYDHSSFA  120
CCSQPSSVCL SHQGIGVEAQ SKVVNEYYYN KSGPEDMLMQ KPITGQNSSY GRDWMVMMDM  180
GPRPSYSSLS PIPCINMMMN SPKIPPKTLE LFPISSINSK QDSSKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00138854001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894320.0AC189432.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068E07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133866.11e-171PREDICTED: WUSCHEL-related homeobox 3-like
RefseqXP_013740679.11e-171PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ9SIB41e-107WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A078D4Q81e-171A0A078D4Q8_BRANA; BnaA03g22070D protein
TrEMBLM4C8F61e-171M4C8F6_BRARP; Uncharacterized protein
STRINGBra000484.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74802642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.15e-93WOX family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]